Detailed information on CNT30709049


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6VAF5|TBB7_GOSHI, E-value = 2e-15

BLAST vs NONCODE:
NONGMAT000219, E-value = 5e-44

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30532757Glycine maxEucalyptus grandis34.4954.3289.54239forward
CNT30517711Glycine maxJuglans regia32.6142.6484.51226forward
CNT30729860Glycine maxCorchorus capsularis73.1654.8182.64507forward
CNT30177039Glycine maxSecale cereale85.2843.5284.43591forward
CNT30284381Glycine maxTriticum aestivum44.4440.3188.96308forward
CNT30224654Glycine maxHordeum vulgare45.1720.584.03313forward
CNT3086234Glycine maxVigna radiata40.6953.2192.55282forward
CNT30144939Glycine maxMedicago truncatula31.3144.5686.18217forward
CNT30247087Glycine maxAvena sativa44.4442.0888.64308forward
CNT30655883Glycine maxTriticum dicoccoides44.4443.1488.64308forward
CNT3059767Glycine maxArabidopsis lyrata33.1932.4483.91230forward
CNT30229012Glycine maxAnanas comosus35.2129.4386.07244forward
CNT30624589Glycine maxDaucus carota16.4522.9891.23114forward
CNT30720142Glycine maxTriticum spelta24.6847.7788.89171forward
CNT30344814Glycine maxEragrostis tef16.3128.3983.19113forward
CNT30358630Glycine maxLactuca sativa20.6336.4886.01143forward
CNT30371350Glycine maxOryza glumipatula43.1536.4682.27299forward
CNT30482824Glycine maxChara braunii35.7932.5981.45248forward
CNT30430260Glycine maxPapaver somniferum30.1635.9187.08209forward
CNT30571197Glycine maxVitis vinifera44.1677.6687.25306forward
CNT30106557Glycine maxOryza longistaminata27.9990.6582.47194forward
CNT3024728Glycine maxPopulus trichocarpa38.9633.2589.26270forward
CNT30593783Glycine maxEragrostis curvula27.1335.6182.45188forward
CNT30333509Glycine maxCynara cardunculus32.3240.7383.93224forward

Expression of CNT30709049

Peptides detected in this lncRNA

>peptide 1 (74 aa)
MNERPLGIHEVKFVVDAREDLNNTGGIGDHAHGPLNLGKITTWNNSRRLVIDSTLEPGGAPVNKLNSALGLDNL*

>peptide 2 (36 aa)
MRQHAMYLPWRGSHLAIIDDGSNALLVISPTDSCSW*

>peptide 3 (80 aa)
QVPRKVQRYTEHEKKNNTESNIIVQTSNHNPLLHHHLQLPLHQLPHNPSPGQQDLHGPQRTPPLPYPHQHTNERTPSWHT*

Sequence

>CNT30709049
CAAGTTCCACGGAAAGTACAACGATACACAGAGCACGAGAAGAAAAACAACACAGAAAGTAACATAATAGTGCAAACTTCTAATCATAATCCTCTCCTTC
ATCACCATCTTCAGTTGCCTCTGCACCAACTTCCTCATAATCCTTCTCCAGGGCAGCAAGATCTTCACGGGCCTCAGAGAACTCCCCCTCTTCCATACCC
TCACCAACATACCAATGAACGAACGCCCTCTTGGCATACATGAGGTCAAATTTGTGGTCGATGCGAGAGAAGACCTCAACAACACTGGTGGAATTGGAGA
TCATGCACACGGCCCTCTGAACCTTGGCAAGATCACCACCTGGAACAACAGTCGGAGGCTGGTAATTGATTCCACACTTGAACCCGGTGGGGCACCAGTC
AACAAATTGAATAGTGCGCTTGGTCTTGATAATCTTTAGGCACTACGTCACCTCTGTACATGAGACAGCACGCCATGTATTTGCCATGGCGGGGATCACA
CTTGGCCATCATAGATGATGGCTCGAATGCACTGTTGGTGATTTCACCAACTGATAGCTGCTCATGGTGAGCCTTCTCGGCTGAAATTACAGGAGCATAA
GATGAAAGCATAAAATGAATCCTGGGGTATGGCACAAGGTTGGTCTGGAATTCATTGACATCAACATTCAAGGCTCCATCAAACCTCAGGGAA