Detailed information on CNT30708966


BLAST search results

BLAST vs Swiss-Prot:
sp|P33624|TBA2_ANEPH, E-value = 2e-18

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3041150Glycine maxChlamydomonas reinhardtii56.3433.1182.78151forward
CNT30620135Glycine maxCajanus cajan5042.8191.04134forward
CNT30174517Glycine maxVigna angularis34.746.2796.7793forward

Expression of CNT30708966

Peptides detected in this lncRNA

>peptide 1 (55 aa)
LELSDIHIDGTIEPQGSGEGRNDLGNEPVEVGSGWRGRCCRVQRLRLKPVGKGKW*

>peptide 2 (46 aa)
WNSVISTLMAPSNLKEVVRDEMIWEMSLLRLGVGGEDAVVGFNDCG*

Sequence

>CNT30708966
CTGGAACTCAGTGATATCCACATTGATGGCACCATCGAACCTCAAGGAAGTGGTGAGGGACGAAATGATCTGGGAAATGAGCCTGTTGAGGTTGGGAGTG
GGTGGAGAGGACGCTGTTGTAGGGTTCAACGACTGCGGTTGAAACCTGTGGGGAAGGGTAAATGGTGAACCCTAATTTGGATTTTTTGCCGTAATCGACG
GAGAGACGCTCGAGTAAGAGAGATCCGAGACCGGAACCGGTGCCACCGCCGACGGCGTTGAAGACGAG