Detailed information on CNT30708850


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9SQL2|CB24_PEA, E-value = 9e-98

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30487770Glycine maxOlea europaea29.4251.6684.12233forward
CNT30395365Glycine maxTriticum turgidum9.7228.2188.3177forward
CNT30138628Glycine maxLolium perenne20.3334.1885.09161forward
CNT30605371Glycine maxGossypium raimondii10.131.59080forward
CNT30205828Glycine maxHelianthus annuus16.5434.0387.02131forward
CNT30723301Glycine maxLupinus angustifolius38.5171.4380305forward

Expression of CNT30708850

Peptides detected in this lncRNA

>peptide 1 (41 aa)
MWGQAVLLEDGVLVDTARVLDVLPSSDLDVVEQDELDHEEG*

>peptide 2 (60 aa)
MSLDTNLVATNCIDDGAKFKGLNTLPGYPHSCGGKLYCLKMGSWLTQPGFLMSCHLRIST*

>peptide 3 (36 aa)
MKIDGSQQSRPNHSQNSSIQDYTRRTQAYPCHWIQT*

>peptide 4 (39 aa)
MDHNNHAQITLKIHPFRITREGHRLIHVIGYKLSSHELY*

Sequence

>CNT30708850
GTTGTATTAGAATTTTGATGAAATTTTTAGAAAGTATCATGCTTGATTACTGATTGATGGACAGTCTAAATAACAATATAAAACCATCGTAGTTCCTCTG
TACATGAAAATAGATGGATCACAACAATCACGCCCAAATCACTCTCAAAATTCATCCATTCAGGATTACACGAGAAGGACACAGGCTTATCCATGTCATT
GGATACAAACTTAGTAGCCACGAATTGTATTGATGATGGTGCAAAGTTCAAGGGGTTGAACACACTACCAGGGTATCCACACTCATGTGGGGGCAAGCTG
TATTGCTTGAAGATGGGGTCTTGGTTGACACAGCCAGGGTTCTTGATGTCCTGCCATCTTCGGATCTCGACGTAGTGGAACAAGATGAACTCGATCACGA
AGAGGGTTGAGGAAGATGCAAAGTACTCTGATTTCCCAGCATCATACCATTGAGGGGCATTGATGATTCCAAACTTGGTGAAAACCTCAGGAAGCAACAT
TCCTGCAACACCCAACATGGCCCAACGTCCATTCACAAGCTCGGCTTGAACGTAAGTTGGGGAGGCCAAGCCAGGTAACCACTCTCCCTTCTTGGCTTCA
ACCTTGAAAGAGGCAGAAGGAGGGCACCCCATTGGCCGCATAGTCACTTCCCGGTTAAGTTTACCGGAAGAGCCGGTCAAAAACCTCGATTTCGAGGTAC
ATGGCCGGAAAATTGCGGCGGAGGCTTGGGTGGTGACGGTGGCCATGGCGGCGACACACGGGCAGTGACAAGGAAGATATGAAGAAAACAAT