Detailed information on CNT30708773


BLAST search results

BLAST vs Swiss-Prot:
sp|P27521|CA4_ARATH, E-value = 5e-73

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30523236Glycine maxSetaria italica29.9476.7383.51188forward
CNT30513114Glycine maxJuglans regia33.673.0184.83211forward
CNT30728535Glycine maxCorchorus capsularis33.2860.5884.69209forward
CNT30381598Glycine maxManihot esculenta59.8767.6385.11376forward
CNT3084615Glycine maxVigna radiata66.8836.493.57420forward
CNT30171733Glycine maxTrifolium pratense49.3644.2981.94310forward
CNT30347972Glycine maxEragrostis tef22.7717.6181.82143forward
CNT30621375Glycine maxCajanus cajan35.5143.7394.17223forward
CNT30573808Glycine maxVitis vinifera55.154.483.24346forward
CNT30604528Glycine maxOryza punctata29.9416.4683.51188forward

Expression of CNT30708773

Peptides detected in this lncRNA

>peptide 1 (57 aa)
MKIDGSQQSRPNHSQNSSIQDYTRRTQPRIVLMMVLCHGSERCCKRFSNVPSPWPPK*

>peptide 2 (66 aa)
MFLLLGLQSRCKVQGVEHTTRVSTLMWGQAVLLEDGVLVDTARVLDVLPSSDLDVVEQDELDHEEG*

Sequence

>CNT30708773
GTTGTATTAGAATTTTGATGAAATTTTTAGAAAGTATCATGCTTGATTACTGATTGATGGACAGTCTAAATAACAATATAAAACCATCGTAGTTCCTCTG
TACATGAAAATAGATGGATCACAACAATCACGCCCAAATCACTCTCAAAATTCATCCATTCAGGATTACACGAGAAGGACACAGCCACGAATTGTATTGA
TGATGGTGTTGTGCCACGGGTCAGAGAGGTGCTGCAAGAGGTTCTCAAATGTTCCTTCTCCTTGGCCTCCAAAGTAGGTGCAAAGTTCAAGGGGTTGAAC
ACACTACCAGGGTATCCACACTCATGTGGGGGCAAGCTGTATTGCTTGAAGATGGGGTCTTGGTTGACACAGCCAGGGTTCTTGATGTCCTGCCATCTTC
GGATCTCGACGTAGTGGAACAAGATGAACTCGATCACGAAGAGGGTTGAGGAAGATGCAAAGTACTCTGATTTCCCAGCATCATACCATTGAGGGGCATT
GATGATTCCAAACTTGGTGAAAACCTCAGGAAGCAACATTCCTGCAACACCCAACATGGCCCAACGTCCATTCACAAGCTCGGCTTGAACGTACCACCTC
AAGGTCAAATCCATTGTCACCAGGAAGA