Detailed information on CNT30708771


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30708771

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MSTDEMTWMYKCFCLCLLQLCKLNWHKIDTNCVGVFEITFIRM*

>peptide 2 (33 aa)
MNLRGRTTQLHINFHLFYKSQRVREVTEESEHT*

>peptide 3 (49 aa)
MLEVMCAHSLSVTPPPSLTTLSSLYPFHFLFIYLFSVYLFSCFPFWCLY*

Sequence

>CNT30708771
TTTCTTCCTTTCATATATATTCAAAACTTCAAATCAAATGAAACAGCTTTCGTGTTAAATATAGATTAGGAAGAATGGTTAGTTGATTGTCTCCTTATAA
CCCTCCTGACCCTTTCAGAAATGAATTTAAGGGGGAGAACCACTCAATTACATATCAACTTTCATTTATTCTATAAAAGTCAAAGGGTAAGGGAGGTGAC
AGAAGAGAGTGAGCACACATAATACTTTCTTGTAAGATAAAGATTCATGCTTGAAGTTATGTGTGCTCACTCTCTATCTGTCACCCCACCACCATCTCTC
ACCACCCTCTCTAGTCTCTACCCTTTTCACTTTCTATTTATATACTTGTTTTCTGTTTATTTATTTTCTTGCTTTCCCTTTTGGTGCTTGTACTAACCCT
AAGTAGCAGCCAGGGACCTCACTATCAGCAAAATAATAAATATTCACACCACATCGATCTCATACATATCACAGGTTTTGAAAATCCTGCCGGTTTGCTA
CGGATACATATTGAACGGTGCGATACAGAATCAATGATGTTCTATTTTCATTGTGTTTAGAATTGAAGGGAAGCTCAGAAAGCGCCTGATGTTGTATTTT
CTTTGGGCTTTGAAGAGGTCGTTTTCGTGGGAAAGAAATGAGTACTGATGAGATGACATGGATGTATAAATGTTTTTGTCTATGTTTGTTGCAGCTGTGC
AAATTAAACTGGCATAAGATTGATACCAATTGTGTAGGGGTTTTTGAGATTACCTTCATTAGGATGTAGTACTATTGAGTATTCAACTAATGTGGATCAA
TTTGAGAACAATTACCATATGTGATACCTCAAATACTTGAATTCC