Detailed information on CNT30708734


BLAST search results

BLAST vs Swiss-Prot:
sp|P56331|IF1A_ONOVI, E-value = 1e-62

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671227Glycine maxSetaria viridis17.6739.2294100forward
CNT30521379Glycine maxSetaria italica5347.7786300forward
CNT30616469Glycine maxSesamum indicum51.4139.3282.13291forward
CNT30630340Glycine maxVigna unguiculata31.6338.8388.83179forward
CNT30304884Glycine maxTriticum aestivum32.3339.787.43183forward
CNT3074265Glycine maxBrassica juncea47.740.9785.56270forward
CNT30476314Glycine maxSaccharum spontaneum48.0639.5386.76272forward
CNT3011199Glycine maxZea mays41.1739.0384.98233forward
CNT30718760Glycine maxMalus domestica golden34.2852.7281.44194forward
CNT30368761Glycine maxSorghum bicolor5316.2688300forward
CNT30619918Glycine maxCajanus cajan76.8619.5191.49435forward
CNT30595805Glycine maxOryza meridionalis30.2139.9592.98171forward
CNT30573246Glycine maxVitis vinifera53.3641.6689.4302forward
CNT3055889Glycine maxAmborella trichopoda41.1732.4181.55233forward
CNT30102311Glycine maxOryza rufipogon5344.8489300forward
CNT30576889Glycine maxOryza barthii48.7642.1488.41276forward
CNT30725237Glycine maxLupinus angustifolius36.9339.4382.78209forward
CNT3039930Glycine maxMarchantia polymorpha41.5234.0178.3235forward

Expression of CNT30708734

Peptides detected in this lncRNA

>peptide 1 (85 aa)
MMSPAAIHTFLCIFPRMWQSLFVPSMHIASHRPFPSIRSTCAYSCPSSLNTSSRFSSSASFFPLFLFLPPFPLFFGILNQTLTLTL

>peptide 2 (39 aa)
MIIEGERGIRFYQYPHPRTRCSRWRWRRPPRPSRRRCPR*

>peptide 3 (37 aa)
VIEIIVHNYKTKSNTESCRQADNEILLETDMMMILYE*

Sequence

>CNT30708734
GGTTATTGAAATAATAGTGCACAATTATAAAACGAAATCCAACACGGAGAGTTGCAGACAAGCAGATAACGAAATATTGCTAGAGACAGATATGATGATG
ATATTATATGAATGATAATTGAGGGCGAGAGAGGGATTAGATTTTATCAATATCCTCATCCTCGAACTCGATGTAGTCGTTGGCGGTGGCGTCGTCCTCC
TCGTCCAAGCCGGCGCCGATGCCCTCGTTGAGGAGCCTGGCCTCGTCGGGCATGTACTTGAGGATGACGTCAGCCTTGTCGTCCTGGTAGTCCCTGAGTC
CAACCAGGATGATGTCTCCGGCGGCGATCCACACCTTCTTGTGCATCTTCCCGCGGATGTGGCAGAGCCTCTTCGTCCCGTCGATGCACATCGCCTCGCA
CCGCCCGTTCCCCAGCATCCGGAGCACCTGCGCGTACTCCTGCCCGTCCTCCTTGAACACCAGCTCCCGCTTCTCGTCGTCCGCCTCGTTCTTTCCCCTC
TTCCTGTTCTTACCTCCCTTTCCCTTGTTCTTCGGCATCCTCAATCAAACCCTAACCCTAACCCTA