Detailed information on CNT30708521


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30727469Glycine maxCorchorus capsularis33.2233.2287.13101forward
CNT3045920Glycine maxPrunus dulcis33.5533.3385.29102forward
CNT30158859Glycine maxPistacia vera22.3723.6991.1868reverse complement
CNT30591720Glycine maxMusa acuminata24.0122.8890.4173forward
CNT3084328Glycine maxVigna radiata52.352.388.05159forward
CNT30146769Glycine maxMedicago truncatula80.2680.2684.43244forward
CNT30653438Glycine maxRosa chinensis24.0123.790.4173forward
CNT30623316Glycine maxDaucus carota23.3623.3687.3271forward
CNT30620685Glycine maxCajanus cajan10031.7783.88304forward
CNT30154558Glycine maxPrunus persica29.2829.0886.5289forward
CNT30410045Glycine maxPapaver somniferum22.0422.6488.0667reverse complement
CNT30706625Glycine maxPrunus avium29.934.7586.8191forward
CNT3029804Glycine maxTheobroma cacao31.2530.9486.3295forward
CNT30108933Glycine maxOryza longistaminata25.6625.1688.4678forward
CNT30319113Glycine maxAsparagus officinalis25.339.5787.0177reverse complement
CNT30120686Glycine maxCitrus clementina33.2233.5586.14101reverse complement
CNT30724020Glycine maxLupinus angustifolius78.9581.6382.92240forward

Expression of CNT30708521

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MAWAMLGWASRCIMLACPLQVKSWVLGLRRRLGSPGS*

Sequence

>CNT30708521
GCCGAGCTGGGTAACGCTAGCATGTAACCTAAGTAGGGGCATCAAAGTGATGGAACATGGCTTGGGCTATGCTCGGTTGGGCTAGTAGATGCATAATGCT
GGCCTGCCCACTCCAAGTTAAGAGTTGGGTCCTGGGACTCAGGCGAAGGCTCGGGTCTCCTGGCTCCTAAACTGGAGGGCACAGCGTGAGGCTGGCTTCA
CAGAGCAGCGATCACCTCCGGCTCTTAACAGTGGAGGGATAACAGGCTGCAGCACTTCTGGCCCACCATGACCGGGTGTATCAAGCTCCTGAACCATCAT
TTTT