Detailed information on CNT30708123


BLAST search results

BLAST vs Swiss-Prot:
sp|P14584|CB21_RAPSA, E-value = 1e-10

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672312Glycine maxSetaria viridis12.4336.0181.33166forward
CNT30276136Glycine maxChenopodium quinoa8.1621.1781.65109forward
CNT30587569Glycine maxMusa acuminata19.1676.4281.25256forward
CNT30244696Glycine maxAvena sativa17.4444.2181.55233forward
CNT30132393Glycine maxLolium perenne18.8642.9380.95252forward
CNT30620951Glycine maxCajanus cajan27.1734.987.88363forward
CNT30556512Glycine maxPanicum hallii10.2528.2581.75137forward

Expression of CNT30708123

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MMVVWSGSLKWVAQLLSGPLPVAAAWTAKPKKPTMARRAPSGSK*

>peptide 2 (31 aa)
MTYNLLSSNYHIIQKHFLIIILQFKFRIISN*

>peptide 3 (38 aa)
PLQFHVTSFSQVLLIQLCRKCLITTQSRRRRKRLLQYN*

>peptide 4 (29 aa)
MYTIIRKKTQIFLSNFHFFVGINCDGIQL*

Sequence

>CNT30708123
AGCCTCTCCAATTTCACGTTACAAGTTTTTCACAAGTACTACTAATCCAGCTATGTAGAAAATGTTTAATTACAACCCAAAGCCGAAGAAGAAGAAAAAG
ACTTTTACAATATAACTAGAATGACCAGGCACAAGAAAGACTATTCTTCTTCTTTTGCTTCTTCTTAAGAGGAGGATGAGAAGGTGTCAATGATGGTTGT
GTGGAGTGGGTCACTCAAGTGGGTGGCCCAGTTGTTGAGCGGGCCCTTGCCAGTGGCGGCAGCTTGGACTGCAAAGCCCAAGAAGCCCACCATGGCGAGA
CGGGCGCCCAGTGGGTCGAAGTAACTGCCACCTGGGTACAGCCTCTTTTCTGGGTCCAGCTCTGCGTTCCTCTGGAACTCTATGTAGCCAATTACGAGAA
CCTCGATCCAGATCAGTGTGGTGATTGAGAATGGAAGTGGTTGCCCTAGGTATGATGAACCTTCCACTAGCTCCACCTTAAAATCAAAGACCATGTTCAT
AATTAATTAAGAAGCCCGTCATGTATACTATCATAAGAAAGAAAACACAAATTTTTCTTTCTAATTTTCACTTTTTCGTGGGTATAAACTGTGATGGAAT
TCAACTCTAGAATCGATAATTGCTACAAAGGTTGTTTGCTAGTAACGTTGTTTAGGACTTCTCTTTCTTAGCATAAGAATTAAGTTTTAAAATAAGATAG
TTTTTTCATGATTTCTAATTGCTAGAACGCATGCATCCGCTCCGACGAACACACAAAAACCGTTATAAAAACATTTCAAACACAACTAATACACTCTAAA
CCAACACGTGCAATCAACACTCCCTATGATTATTCTTTGTAATAATAAAAATATACAAAATAATTATAATAAGATTCAATGACATATAATTTACTGTCAT
CAAATTATCATATAATACAAAAACATTTTTTAATAATTATTTTACAATTTAAATTTAGAATAATTTCTAATTAATCCACGGTATAAAAATTTTGTATTAC
AAATATATAAAAAAAATATACTGATATTATTATGCAAATTATCAGATAAATGTTTTAGTATGAGACAACAGTCACTTCTTACTAAAAACAATTTTACTCG
ATCAATAAGATATAATAAAATGTATATTTAACTCTAGACTACTAATTAACCTGAAATAATCTCTAAGCTGAAACAATTATCAATCCGGTTAGTTAGTATA
CAAGTGTGGTGTAATGTAAAGTTTCTTTTAGTCAGACATATGACAATCTCTTCAATTTGACATAATTCATGTAAAACTAGCATCTTATTAAAATCATTTC
AACTAATTTTCTAATTATAACATTATTTTAACTAAT