Detailed information on CNT30697920


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30590960Oryza sativaMusa acuminata14.4257.7582.32164forward
CNT30371395Oryza sativaOryza glumipatula48.3798.7493.27550forward
CNT30104541Oryza sativaOryza rufipogon66.3169.9499.87754forward
CNT30578423Oryza sativaOryza barthii100.26101.5190.181140forward
CNT30118048Oryza sativaOryza nivara68.4337.0591.39778forward

Expression of CNT30697920

Peptides detected in this lncRNA

>peptide 1 (55 aa)
NHSLTHTAIYSYVPCNNNTYLTKFTNNAGELINVIHHISWLPDDSHISIDNLFHW*

>peptide 2 (30 aa)
ITHSLTQQYIATYHAIITHTSQNSPIMQEN*

>peptide 3 (49 aa)
MSSQESRPTRLLNSVKVVRGDLMRWNPISMSSCLVCSGVFPPSSMLHTR*

>peptide 4 (33 aa)
MMLNNNSLIYGDLYWYEYILLVNRKRNNCIIRS*

Sequence

>CNT30697920
AATCACTCACTCACTCACACAGCAATATATAGCTACGTACCATGCAATAATAACACATACCTCACAAAATTCACCAATAATGCAGGAGAATTAATCAATG
TAATCCACCATATTTCATGGCTCCCTGATGACAGCCACATTTCGATTGATAATTTATTCCATTGGTAGCTTGATCTTGATCGATCTTAGTGTACCCCATT
GGTAGCTCCGTTTCCGGCGACGACGGCGGCCGCCTTGGCCTTGGCCTTCTCCATCTCCGTCGTGGTCTCCAGCGCCGGTGGTGCCGGGAGCGGCTTGGGA
ACGGAGGAGGAGGAGTTGACGGAGAAGCGAACCTCGATGTCGAGCCAGGAGTCGAGGCCGACGAGGTTGTTGAACTCGGTGAAGGTGGTGAGGGGGGACT
TGATGAGGTGGAACCCCATCTCCATGAGCTCCTGCCTCGTGTGCAGCGGCGTCTTCCCGCCCTCCAGCATGTTGCACACGCGATAACCCTTGGTCCTCCT
GCAGATCTCCATCAGCTCCTCGTCGCTCCGCGGCGCCTCCACGAAGCACGCGTCTGCTCCCGCCTACAATTTTTTTTTTACATATATTCATATTAGATAT
GATATGATGTTGAATAATAATAGCTTAATTTACGGTGATCTCTACTGGTATGAATATATCCTACTAGTAAATAGGAAAAGAAATAATTGTATTATCCGTA
GTTGAGGTACGTATAGTAATATAATTGATAGGATTTTATTTGATTAGAAGAAAATGAACGGTTTAGATTGGATTCTACAACCAGTAAAGACCAATGTAAA
AACACCAATGGGTTAAATTCCATTATATAGGAGAAAAATATACCACAGACATTGTTTGTGAGCCTAATATATAATAGAAGACAAAGATACAAACCATTTT
CATTTCATCATGTAAAAAGAAAGTGTTTTCGCCTCACATATATCAGTTTTCAAAATGCAACTTTGACCAATATCTAATGAAAGAACTAATTAATTTCAAA
ACATTGATTCTTGACAGACTTGAACTTGTTTAAGATTAATAGTTGGTGGTTGAGATCGATCAAATTTAAACGAGAGTTTGACTCTGAAGAGATTCTCTAG
AACATGATTTATCTCTCTCTAGAAAAAAGAAGTGGTC