Detailed information on CNT30697884


BLAST search results

BLAST vs Swiss-Prot:
sp|P01053|ICI2_HORVU, E-value = 6e-19

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555553Oryza sativaOryza glaberrima74.1158.7790.99355forward
CNT30471857Oryza sativaSaccharum spontaneum33.8226.2684.57162forward
CNT30104461Oryza sativaOryza rufipogon92.977.1293.71445forward
CNT30578397Oryza sativaOryza barthii70.35102.1293.47337forward

Expression of CNT30697884

Peptides detected in this lncRNA

>peptide 1 (34 aa)
SIFIHRKKTLTVKHYSDGDGSIETCTQYISLACM*

>peptide 2 (79 aa)
MVGVPATVSTKMRTRLGRKSMVTGVPTGTTTMSASGMSLRITFFASSARSPTTSGHDVFPSSPPELISPTTSHLRTRSN*

>peptide 3 (84 aa)
MGMDRSKHAHSTYHLRACDHYLIKIKMAGGPGAEGRQMRLVASSSRWWGCRRRCRRRCGRGWGGSPWSPASPPEPRRCRRRACP*

Sequence

>CNT30697884
CTTCCATATTTATTCATAGGAAAAAAACATTGACGGTAAAACATTATTCAGATGGGGATGGATCGATCGAAACATGCACACAGTACATATCACTTGCGTG
CATGTGATCATTATTTAATTAAGATAAAGATGGCCGGGGGCCCGGGCGCTGAAGGAAGGCAGATGAGGCTAGTAGCTAGCTCTAGCCGATGGTGGGGGTG
CCGGCGACGGTGTCGACGAAGATGCGGACGCGGTTGGGGCGGAAGTCCATGGTCACCGGCGTCCCCACCGGAACCACGACGATGTCGGCGTCGGGCATGT
CCTTGAGGATCACCTTCTTCGCCTCCTCCGCCCGCAGCCCCACCACCTCCGGCCACGACGTCTTCCCCTCCTCGCCGCCGGAGCTCATCTCGCCGACGAC
CTCACACCTCCGGACACGATCAAACTGATGATGAGCTATCAGCAATTAATGTAAACTTTTGAGAGAGTATATATGTAGC