Detailed information on CNT30697825


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT000350, E-value = 2e-153

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3099458Oryza sativaOryza rufipogon56.5859.2390.7215forward

Expression of CNT30697825

Peptides detected in this lncRNA

>peptide 1 (89 aa)
MLALCKRTFSLPWIYLASYLLFRYDLLSTVGSTQSCSFPHTRVGVLLSWRCLEEVGFVAAVKGCLWNGIARCRSQVFRLSSLLPFSLHL*

>peptide 2 (29 aa)
MSGRGWFRRCRQGLPVEWNRPLQESSLQA*

>peptide 3 (43 aa)
MESPAAGVKSSGLARFYLFRCICNPLYFCKTWICMSTIVVCVPW

Sequence

>CNT30697825
ATGGATTAATTACTACAACTGTTTTACTGCTTTCAACTTTTGCATTTAAATGCTAGCTTTATGCAAAAGAACCTTTAGCCTCCCTTGGATATATCTTGCA
TCATACCTCCTCTTCCGGTATGACTTGCTGAGTACAGTGGGTAGTACTCAGTCTTGCTCTTTTCCCCACACCAGAGTTGGAGTTCTTCTTAGTTGGAGAT
GTCTGGAAGAGGTTGGTTTCGTCGCTGCCGTCAAGGGTTGCCTGTGGAATGGAATCGCCCGCTGCAGGAGTCAAGTCTTCAGGCTTAGCTCGCTTTTACC
TTTTTCGCTGCATTTGTAATCCTTTATATTTTTGTAAGACGTGGATCTGTATGTCAACAATTGTCGTTTGTGTACCCTGG