Detailed information on CNT30697810


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0IQF7|RS16_ORYSJ, E-value = 2e-73

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30295032Oryza sativaTriticum aestivum51.555.9485.96292forward
CNT30562499Oryza sativaActinidia chinensis20.4652.2588.79116forward
CNT30232050Oryza sativaAnanas comosus57.8528.885.67328forward
CNT30365247Oryza sativaSorghum bicolor59.7949.9391.15339forward
CNT30620437Oryza sativaCajanus cajan20.4616.2787.93116forward
CNT30118078Oryza sativaOryza nivara10090.2999.82567forward

Expression of CNT30697810

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MSMSLKRERPASRMGSNALRRSISGLISSIGTPFTLISPRPGLQ*

Sequence

>CNT30697810
AGTAGAGTCTTAAACATTTCAATCACATCCATTTCACAATGTCAAAAAGGCAAGGTTCAGGGCTAAGTTTTAAAAGACTAAACTTGAAAGTAATGCAGTA
GCTAGATAGATGTAGAACAAGCCAAGTAGCTCCATTGATAGGGTGGAAAAGAGAACACCGCTCCGAATCGGTCCGGCGAGCGCTCAGCGGTACGACTTCT
GGAACCTTGCGCGGGCGCCGCGACCACCGAACTTCTTGGGCTCGCAGCGCCTGGGGTCGGCGACGAGGGCCTTGGCGATGGCCTGGCGGATCGCGTAGAT
CTGCGACGTCTTCCCACCGCCGCGGACGCGGATCCTCATGTCGATGTCCTTGAAGCGCGAGCGCCCCGCGAGCAGGATGGGCTCGAACGCCTTGAGGCGG
AGCATCTCCGGCCTGATCAGCTCGATCGGGACGCCGTTCACCTTGATCAGCCCGCGCCCCGGCTTGCAGTAGGAGACGGCCACCGCCGTCTTCTTGCGCC
CGAAGCACTGGACCGTGCCTGGAGGCGGGCGGGTGAGCGCGGCGGCCATGGTTGCGGTGGTGGCGCG