Detailed information on CNT30697790


BLAST search results

BLAST vs Swiss-Prot:
sp|Q2QYL2|NLT2B_ORYSJ, E-value = 8e-43

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555885Oryza sativaOryza glaberrima27.1617.9296.92195forward

Expression of CNT30697790

Peptides detected in this lncRNA

>peptide 1 (67 aa)
MAAMVVCGPARSRAATRATNTSCARAISILVVCADDRSTLLLLLVCGARLLLQVRSIDENSRECRGL*

>peptide 2 (61 aa)
MLTPHLEGMLAALPALRPLMLPATFLRQLQAVRRSAVVVAAELRLLTPLQQAADGPEPPRA*

Sequence

>CNT30697790
ACAAAGCGTGAGACGACAGCTGCATCTCGGCCGGCGCTGCATGTCATCCTCCGGTAGCGATCGATCGGATTAGTTCACGCTGCACTCGATGGAGGGGCTG
ATGGTGTAGGGGATGCTGACGCCGCACTTGGAGGGGATGCTGGCGGCATTGCCGGCGTTGAGGCCGCTGATGCTGCCGGCCACGTTCTTGAGGCAGTTGC
AGGCGGTGCGGCGGTCGGCGGTGGTGGTGGCGGCGGAGTTGAGGCTCCTGACGCCGCTGCAGCAGGCCGCCGACGGGCCGGAGCCGCCGCGGGCGTAGCT
GAGGCAGGGCGACACGGCGGAGTTGACCTGGCCGCAGCTGATGGCGGCCATGGTGGTGTGTGGGCCCGCCAGGAGCAGAGCTGCCACGAGGGCGACCAAC
ACCAGCTGTGCACGGGCCATCTCGATCTTGGTCGTGTGTGCTGACGATCGATCGACTTTGCTGCTGCTGCTGGTGTGTGGTGCTCGTTTGCTGCTGCAGG
TGAGATCGATCGATGAGAATTCCCGGGAATGTAGGGGGCTTTAAATAGCTATGATTTCATCTGTGCCGATGCATCGACCAAGTCAAATGTAGTTACTACG
TGGAATATATAGTCCACCTATAATTAGAGAACATATCCTATACACACAAGCTTTACTTATGTACACACTATACATATCAATTAGCAAATGTCATAAAAAA
TTTTAGAAAAAATTGGAC