Detailed information on CNT30697760


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30453790Oryza sativaSaccharum spontaneum21.487.7393.158forward
CNT302340Oryza sativaZea mays32.5919.2693.1888forward
CNT30367085Oryza sativaSorghum bicolor21.4815.2693.158forward
CNT30496705Oryza sativaDigitaria exilis21.4815.8993.158forward
CNT30604867Oryza sativaOryza punctata81.1157.3382.19219forward
CNT30557192Oryza sativaPanicum hallii21.4813.6893.158forward

Expression of CNT30697760

Peptides detected in this lncRNA

>peptide 1 (37 aa)
STLRFIHSFHLIKANTRRAFFLRSKTQMGNHTVTQTR*

>peptide 2 (36 aa)
EHTKIHSFISFDQSKHETSFLLAIKNTDGQPHSNTN*

Sequence

>CNT30697760
GAGCACACTAAGATTCATTCATTCATTTCATTTGATCAAAGCAAACACGAGACGAGCTTTCTTCTTGCGATCAAAAACACAGATGGGCAACCACACAGTA
ACACAAACTAGATAGTAGTTCCACACAAAACTAACGATGATAACGATCGGATGATGATGATGGTAGCTCGATTAGATAGATAGATAACTTGGCCATGAGG
GCCCCACCGCTCAGTTCCTCCAGTTCCCGTCGGAGTTGCGAGGCCGCCGACGAAGCAGCGGTACTCAACA