Detailed information on CNT30697738


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001966, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30697738

Peptides detected in this lncRNA

>peptide 1 (64 aa)
MHSINQHDSNEKMKHFFLAVMQERQTEPYSVLFCRIEHCSINSTEIILLFVICNWKWENGIDIL*

>peptide 2 (78 aa)
MQRAVLRIDLPGSSQSSEKLQILHPAEYKEYSTRLYLCNSRGVRKVEGEDGVGLEILGLKEFSHLLQRLFLLILVLVH*

>peptide 3 (74 aa)
MGNRQHYYSSLLLHASCREQCCELICQALHSRRRNCRFSTQLNIRSTLQDYTSAIPGVLGKWKVRTELGLKYLD*

Sequence

>CNT30697738
AGTAAATCATGCATTTGAAGTAGTAGGGAAACCAATACCATTATCAATTGTAGCATGCACATGAGAGCAGCTGGACAAATCAAAGCATGATCGAGTTAAA
AATGAATGGGAAACAGGCAACATTACTACAGTAGTTTATTACTCCATGCCTCATGCAGAGAGCAGTGCTGCGAATTGATCTGCCAGGCTCTTCACAGTCG
TCGGAGAAACTGCAGATTCTCCACCCAGCTGAATATAAGGAGTACTCTACAAGATTATACCTCTGCAATTCCAGGGGTGTTAGGAAAGTGGAAGGTGAGG
ACGGAGTTGGGCTTGAAATACTTGGACTGAAAGAATTCAGTCACCTTCTCCAGAGACTCTTCCTCCTCATCCTCGTACTTGTCCACTGACACGAGACGGT
CGCGCACTGAGCTCTCCAGCTGCACGCCGTACTGTGATCCTTTGATCTCCTTGATCACCACGATCCTGAATAGTTTCTCCACAGGAGCTAGCGTACATGC
ACAGCATCAATCAGCATGACTCAAATGAAAAAATGAAACATTTTTTTCTTGCAGTTATGCAGGAGCGGCAGACTGAACCTTACTCTGTTTTATTTTGTAG
GATAGAACATTGTTCTATAAACTCTACAGAGATAATACTACTATTTGTGATCTGTAACTGGAAATGGGAGAATGGTATTGATATACTATAGACAAGCAAT
TCCAAATCCGTTTTACATATTTCTGAAATGCAAAACCTGAATGGTGGAGTCATTTTAGTTACCAGAAACTAGGGCCTGAAAGAAGCCATCATCCTGCACA
AGCTCCTCTGCCTTCTTGCCCTTCCAACTCTCCAAATGCCCTAGTACATTGTCCTTTTCAAGATACACCCCGATGGCGTTGTATTTGATCTGAAGGAAAT
GAATCTCAATGTCTGTAATGCCTGCAATTTGTTGTTTCAAATGCATTTAGAGGCTTGTGTTGTACTCATAATCTGGTATTAGTCAAATGGAGTACTTATA
AATCATTAATAGATT