Detailed information on CNT30697725


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555744Oryza sativaOryza glaberrima93.6299.5399.68631forward
CNT30104612Oryza sativaOryza rufipogon88.8796.15100599forward
CNT30118020Oryza sativaOryza nivara64.2465.3199.54433forward

Expression of CNT30697725

Peptides detected in this lncRNA

>peptide 1 (47 aa)
MASHSCHGMTFLHYYSGPPNVQSQKRWIESINHCLFCLYTKKVHLFC*

Sequence

>CNT30697725
TCCCAACCTAGTAGCGGCGAATAGTTGAATTCCCCGGCTTCGCCCCCGAATTAACGTGGGGTCGAGGTTCTTTCATCATCGCTCGATCTGCGCCCCGTCG
ATGTGTGTGGTCGTGGTTTGGGTGGGGATTGCTTAACCGGCGCTGTTTGCGGCGGATCAAGCCTCCTTCGACCTTTGCGAAGCAGTCTGAGCGTGAGCGG
GGAAGGAGTTGAAGACAGGCATTGAGAAGGGTGCTCCAGATCCAGTGGATCTTTTCCGATCCAGGTATCAGAGTGCTCGGGTAAGCTCAAGGTCATTTAC
AATTGGAATGCTTTTGTCTGATTTCTTGAGGCGCTGGCACTTCTTGAGGATTGGTATCCATCAAATCAACGAGTTGGGCAAATAGATATCCTTCACAACA
AGAGAAAGTTGTATCCATGGCAGCAAACTCAGGTTCTTCAAACATAAATGTAGATCCATAAACATTTTTTGATTCCTCATATGGCATCTCATTCATGCCA
TGGTATGACATTTTTACATTATTATAGTGGTCCACCTAATGTTCAATCACAAAAAAGGTGGATAGAGTCAATTAACCATTGTCTATTTTGTTTGTATACA
AAAAAAGTTCACTTGTTTTGCTAACCTTGATTATATTTCCCTTTTTCTTGTCAATTATCAAACCTCTGATCATA