Detailed information on CNT30697724


BLAST search results

BLAST vs Swiss-Prot:
sp|Q2QYL2|NLT2B_ORYSJ, E-value = 5e-43

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676413Oryza sativaSetaria viridis15.2230.3591.07112forward
CNT30524117Oryza sativaSetaria italica16.1732.5190.76119forward
CNT30471439Oryza sativaSaccharum spontaneum16.1744.7494.12119forward
CNT30367388Oryza sativaSorghum bicolor9.9220.1189.0473forward
CNT30151138Oryza sativaBrachypodium distachyon8.1520.279560forward
CNT30104631Oryza sativaOryza rufipogon26.6356.32100196forward
CNT30578263Oryza sativaOryza barthii26.4919.1699.49195forward
CNT30117882Oryza sativaOryza nivara18.8931.9597.84139forward

Expression of CNT30697724

Peptides detected in this lncRNA

>peptide 1 (67 aa)
MAAMVVCGPARSRAATRATNTSCARAISILVVCADDRSTLLLLLVCGARLLLQVRSIDENSRECRGL*

>peptide 2 (61 aa)
MLTPHLEGMLAALPALRPLMLPATFLRQLQAVRRSAVVVAAELRLLTPLQQAADGPEPPRA*

Sequence

>CNT30697724
CAAAAACTGATCTCTAGCTCTCAGGTACGTATAGTCGATCGACGAATAAATTAAGGAAACAGATAGCGTAGTGACCGGCCGGGCGATCAACCATGTATGC
ATGGCGATGGATCGACCTAGCTAGCTAGCTCTCATTTTATTCAGCATAAACACAGATAACACAAGATACAAAGCGTGAGACGACAGCTGCATCTCGGCCG
GCGCTGCATGTCATCCTCCGGTAGCGATCGATCGGATTAGTTCACGCTGCACCAGTCGATGGAGGGGCTGATGGTGTAGGGGATGCTGACGCCGCACTTG
GAGGGGATGCTGGCGGCATTGCCGGCGTTGAGGCCGCTGATGCTGCCGGCCACGTTCTTGAGGCAGTTGCAGGCGGTGCGGCGGTCGGCGGTGGTGGTGG
CGGCGGAGTTGAGGCTCCTGACGCCGCTGCAGCAGGCCGCCGACGGGCCGGAGCCGCCGCGGGCGTAGCTGAGGCAGGGCGACACGGCGGAGTTGACCTG
GCCGCAGCTGATGGCGGCCATGGTGGTGTGTGGGCCCGCCAGGAGCAGAGCTGCCACGAGGGCGACCAACACCAGCTGTGCACGGGCCATCTCGATCTTG
GTCGTGTGTGCTGACGATCGATCGACTTTGCTGCTGCTGCTGGTGTGTGGTGCTCGTTTGCTGCTGCAGGTGAGATCGATCGATGAGAATTCCCGGGAAT
GTAGGGGGCTTTAAATAGCTATGATTTCATCTGTGC