Detailed information on CNT30697530


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT000678, E-value = 8e-71

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555565Oryza sativaOryza glaberrima28.5139.7699.52837forward
CNT30371506Oryza sativaOryza glumipatula28.5127.3498.92837forward
CNT30110392Oryza sativaOryza longistaminata20.5748.0194.04604reverse complement
CNT30104613Oryza sativaOryza rufipogon42.245.299.441239forward
CNT30578599Oryza sativaOryza barthii28.5127.5499.16837forward
CNT30117986Oryza sativaOryza nivara28.5141.66100837forward

Expression of CNT30697530

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MYWFVLDFTELLLSRMNYSLLPKKRQTLISVSNV*

>peptide 2 (29 aa)
MHNICDAYCIRFLEYNYMHVCMQTYSGKL*

>peptide 3 (33 aa)
MEPKVSKLETIKSGVIITAGSWFNTCTYGILTF*

>peptide 4 (31 aa)
MNADMNKPMNCITEIKITLISLVLIYAYMLN*

>peptide 5 (33 aa)
MWFSSSFKNPSLLFYCCSSGSKGDSPPWPFLYR*

>peptide 6 (68 aa)
SSSRFPLSLSRSLLSLALWRTRAAPPIVGCVAAASAWLAGKVPPPPLLPPLPFLQSSLPLFPSLNLSI*

>peptide 7 (79 aa)
LFLPFSPFSFSLSSLPGAVAHKGCAPNCRVCRRRLCLAGRQGAAAAASSSSPLPSILSSLVSLSKSLYIAHLPFSPLLP*

>peptide 8 (38 aa)
MQTQIHNLLISHAILQIKLLIIYDVFSIKSGLSFITFK*

>peptide 9 (64 aa)
MKKIKKISHAHKVLIMFYHLTTIKILIIKNFHIRRTIKRWHGNPGFVFFWNGGSNFFWTEGVTL*

Sequence

>CNT30697530
CTCTTCCTCCCGTTTTCCCCTTTCTCTTTCTCGCTCTCTTCTCTCCCTGGCGCTGTGGCGCACAAGGGCTGCGCCCCCAATTGTAGGGTGTGTCGCCGCC
GCCTCTGCCTGGCTGGCCGGCAAGGTGCCGCCGCCGCCGCTTCTTCCTCCTCTCCCCTTCCTTCAATCCTCTCTTCCCTTGTTTCCCTCTCTAAATCTCT
CTATATAGCTCATCTTCCCTTTTCTCCTCTACTGCCCTAGTTAGTATTATCCTCAATCTCTTCAACTTCTGCTCTATGCTAGTGTTTATCTCTCCTTGGT
GATGTCTGTGATAGCGGTGGACTAGTGATGCTGGTTGTATATAAATGATCCTAGTGGTCACTTGATTTTTTTTCTATACTCAGGGTTGTGCTTACTGATT
TCAGGGTTCTTACGTTTGACTTGGTTTGGTGAATAATGTCTATATGCTCATGATAAATGAATGCTGACATGAATAAACCTATGAATTGCATTACTGAAAT
TAAAATCACACTAATATCACTGGTCCTTATATATGCATACATGTTGAATTAACTGAATCTTCTAAAATTGGTGACATACAAGCAGGATCAGATCTTTGAC
TAAAGTCTTATTAATTTACATGGTTCTACACTTTGATAATCATGGCAATTTCTATCTATACATATTGAATTATTGGACTGAAGATCCCTAAAACTTGAAT
CTTGAAGTTAATAAATGATAATTTGTTTCTCTAAATAATTTACTACTAGTCTATATGTCCAGAATTTCATCTCTATATAATTTATTAGATTAGAGTTATT
GATAGATTATATTACTTACATTTGTTTTATTATGAGACTATGCTCTAAACATTTACTCTCCTGCACATAATAATCTGGTAAAGAAACTTGCATGTTCTGT
TAAGTCTTTACGATTTAGTACAACTATTATTACTTTAACACTATACATGCTTAAATGTACATCCAGATTCATCCTATGACGTCTTTTCTGAATTTTGTAG
TAAAGAACTAGATACATATGCAAACCCAGATTCATAACCTACTAATTTCACATGCTATCCTTCAAATCAAACTATTAATAATTTATGATGTTTTCTCTAT
TAAATCAGGGTTGAGCTTCATTACTTTTAAATGAAATCAGATTCATAGACACAGATCCTAACCCTTCCAGGAATATGCACATGTCAAGGTTATGCCCTGT
TTGCATGACTAGAATATGAAAACTTACAAATTCTCATGCATGATCAGTTTCTTCTATACATGCTCTATTCCTAAATAATTTATATCATGAACACTAGTTG
ATTTATACAAGAATTACAGCTACACATGCTTATTGATGCTATCAAGATTTCATATATTATAATTGATATACGTCTATATTAAGATTTAAAGACATACATT
TATCTTAAACTATAGCCTCCTAATTTTTGTCACTTATATTCATTTGGAATTTCTAAGGTTTTGGTCAGTATGGATGGTGCATATATCTGTATGAAACTCT
AGCTCTAACAAATGCTGTTACTATGAATGCAGGATCTACTCTCCTTCCCTATTTTAATTTTTGGTTACCTCTGATGATTCTACAGTGATTGAAAAATATG
TGGTTCAGCTCCTCCTTCAAAAATCCAAGTCTTCTCTTCTACTGCTGCTCTTCTGGATCTAAAGGTGATTCTCCTCCTTGGCCCTTCCTCTACCGGTAAT
ACTTGACTGCTTCCTGACATCTTTCTTGATCTGCTACTGGTGATTCTCTTCCTCCTCTTGAGACTGATCCTCTTGCTTGATTATTGCTGCTCTATCTTGC
TTCCTAACCTTGGTAACATCTTCTCCAAGAGCTGAAACCCCTGTTCATCCAAGAACAGAACACCCTGCTTCTCCTTTTACTCCTCTGACCTCCCTCTCTC
TCTCTTCCTGATTGTTTTTACTATGGATACTATGCAGCTATGGTTAATTGATGTATTGGTTTGTGCTGGATTTCACTGAGCTGCTCCTCTCTCGAATGAA
CTACTCCCTCCTTCCAAAAAAAAGACAAACCCTGATTTCCGTGTCCAACGTTTGACCGTCCGTCTTATTTAAAAAAATTATGAAAAAAATTAAAAAGATA
AGTCACGCGCATAAAGTATTAATCATGTTTTATCATCTAACAACAATAAAAATACTAATTATAAAAAATTTTCATATAAGACGGACAATCAAACGTTGGC
ATGGAAATCCAGGGTTTGTCTTTTTTTGGAACGGAGGGAGTAATTTTTTTTGGACGGAGGGAGTAACTCTCTAGCTAAGCTACTTGCTACTACAGCTGTT
GTTGCTCTTCTTAGCTGAGCCATACTACTCTACTACTGTTGCAACTGCTGCTAATGCTGTTCCTCGAGGTCGTCTCCCAGCCAAAGCAACATGATGGCTA
GTCTACTAGCTTGGCTAATATTTGTATGTAATTTGTGAGGGCATGGTGATGCAGCTGCCTGCATGTCGGTTTGGAAAAGGACTTGCTGCCACCTCATTTT
TCACCTAATCAATTTGGGGTGAAAAAAGTAATTTCCTCTTTGATGTCATTTTGGTGATTACATGGAACCTAAAGTCAGTAAATTAGAAACTATTAAGAGC
GGCGTTATAATTACAGCAGGAAGTTGGTTTAACACGTGTACTTATGGAATTCTTACATTCTAGTCCTTAAGGTTTTATAATATTTAAGATTTTACTAGAG
CTCGAGGACTGATTTGTAATTGCTCTATGACTGAAGAGTTTTTCTGAAAAATAAATAATTATTGAATCTTTGACTGAGATGTTTCAGTTTATGATATGGT
ATCTATAAGCACCTTGTAAATGCACAATATATGTGATGCATACTGTATAAGATTTCTAGAGTACAATTATATGCATGTATGTATGCAGACCTATAGTGGT
AAATTGTAAATAAAGAGATGTGGTTTCTACTGTGCA