Detailed information on CNT30697509


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30111180Oryza sativaOryza longistaminata13.6922.0186.0879forward
CNT30117968Oryza sativaOryza nivara75.7442.9386.27437forward

Expression of CNT30697509

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MYSSTVPFFVSCCVLSSRSATNIHSQGVLPLRSVRLR*

>peptide 2 (44 aa)
MDVLQYRAIFCFLLCSEQPVGDKHTQSRCSAASFCPPKVKTKWS*

Sequence

>CNT30697509
AAAAATTGCTCTGGTTTTCTGGTGGTTGTAGAGAGAAGATATATGGGGACCACAAATTGTCCCTCGTTACTGGTCCCTGAATAGGGACATGCTTGCTTTG
ACTCCAATGGAACGCAATCAATTGTTCCAACCGGCTGGCCAGCAGTGACCGGGATGTTTTACTCCATCAAAAACATGGCGTGACCGTGCGAGTCAAGAAG
GAACACGCCAATACCTTATGTTCAGTTTGACAGCACGCCCGGATGGATGTACTCCAGTACCGTGCCATTTTTTGTTTCCTGTTGTGTTCTGAGCAGCCGG
TCGGCGACAAACATACACAGTCAAGGTGTTCTGCCGCTTCGTTCTGTCCGCCTAAGGTAAAAACAAAATGGAGCTGATTTTGAAAAGAGAACTACTGCCG
GGCGAGGATGGTCTGGATGGATGGATCAACTTTGAAAAGAAATAAGATGTATGTTAAACATCTCATTCTTTTGCTGATGCGCTGAAACGAGGTGACGGAG
ATGTTGCTGCACTGGCTGCTGTCACCGGCGTGTGCCGCAGCCTGCAGCTCGCTGCTGCTGCTGCCCGGACTCTGGCA