Detailed information on CNT30697490


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30104527Oryza sativaOryza rufipogon77.793.64100648forward

Expression of CNT30697490

Peptides detected in this lncRNA

>peptide 1 (32 aa)
SYINCYLDMVYVESNPCFYSADVSCCFERPCC*

>peptide 2 (35 aa)
MKFWSVRRRTVAIATQHLCFQGIGAKQIHSHFADR*

>peptide 3 (32 aa)
MRCNRNPLIMLRTSGTEIWTTVYRVSIGKSQQ*

>peptide 4 (69 aa)
MKTSQKMQFNTWRMLFCAMCTFLVEIPVRTSHICIFLYNCSLFSCAQAAYFCFRLQSARKMELGEHSLE*

Sequence

>CNT30697490
AGCTACATAAACTGTTACCTCGACATGGTTTATGTTGAGTCAAATCCCTGTTTCTACTCGGCAGATGTAAGTTGTTGCTTCGAACGTCCTTGTTGTTGAT
GGAAATTCAGAATCACCCACTTTGGATATGGAGATGAAGCTGTGATGAAATTCTGGTCGGTGAGGAGACGGACTGTTGCCATTGCCACGCAACACCTCTG
CTTCCAGGGGATTGGTGCCAAACAAATACACTCACACTTTGCTGATAGATGAGAACTGTAAAGAAGGTAACTGGGCAGGGTGCCAGGGTCTATAAGGCTG
TATTCTGAAATGCATCAGAATGATATTCATCCAGATTATTGATTGCACATAATGCCTTGTTTAAGGATTTGATGAAGACCAGTCAAAAAATGCAATTCAA
TACTTGGAGAATGTTGTTTTGTGCCATGTGTACTTTTTTAGTGGAAATCCCTGTAAGAACATCTCATATATGCATATTTCTGTACAATTGTTCATTATTT
AGCTGTGCTCAGGCAGCATATTTTTGTTTTCGTCTTCAATCAGCAAGGAAGATGGAGCTTGGGGAACATTCTCTTGAGTAAAGAAGTTGGGTTCTTTCCA
GACAGATAGTACATTCCTTCTATGTTGCCTTCTATTTTTTGTAAATTTTTTTCCTTGGTCTCATGTTCATGAAGAAACAGTTCTCCATTGATCTTCTCTT
TTGATGAGGTGTAATAGGAATCCCTTGATCATGTTGAGAACATCTGGGACTGAGATTTGGACAACAGTATATAGGGTTTCTATTGGTAAAAGTCAACAAT
GATTCGTTGAAATGATTAATGCTTGTATAAGTGA