Detailed information on CNT30697339


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9LHA8|HS704_ARATH, E-value = 2e-69

BLAST vs NONCODE:
NONVVIT003131, E-value = 9e-51

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673056Oryza sativaSetaria viridis51.4269.8789.45218forward
CNT30520958Oryza sativaSetaria italica60.6118.4489.88257forward
CNT30616016Oryza sativaSesamum indicum35.1449.589.26149forward
CNT30381739Oryza sativaManihot esculenta49.2928.7184.69209forward
CNT30630063Oryza sativaVigna unguiculata42.9230.888.46182forward
CNT30490395Oryza sativaOlea europaea62.0332.9686.69263forward
CNT30161017Oryza sativaPistacia vera30.957.9684.73131forward
CNT30283475Oryza sativaTriticum aestivum49.5326.8289.52210forward
CNT30225079Oryza sativaHordeum vulgare34.4353.8786.99146forward
CNT30383257Oryza sativaTriticum turgidum60.8539.0389.53258forward
CNT30568743Oryza sativaActinidia chinensis34.6747.1285.71147forward
CNT30588413Oryza sativaMusa acuminata42.4579.6588.33180forward
CNT30510893Oryza sativaSolanum lycopersicum22.6446.8386.4696forward
CNT30145283Oryza sativaMedicago truncatula22.8828.2886.697forward
CNT30441947Oryza sativaAegilops tauschii60.3833.692.19256forward
CNT30231854Oryza sativaAnanas comosus34.6754.4486.39147forward
CNT3067065Oryza sativaLeersia perrieri41.5141.4188.07176forward
CNT30621132Oryza sativaCajanus cajan31.8423.0886.67135forward
CNT30151237Oryza sativaBrachypodium distachyon50.7140.5794.42215forward
CNT30112153Oryza sativaFicus carica43.420.4485.33184forward
CNT30114516Oryza sativaEutrema salsugineum16.7524.3287.3271forward

Expression of CNT30697339

Peptides detected in this lncRNA

>peptide 1 (39 aa)
VRCRELRGDLLILDGVAHVVGVVLQRVLGLHLLLVLLIL*

>peptide 2 (77 aa)
MVILFFCPVVLSSADTFRIPLASMSKQTVEKTCSFLVGMVVFLGIKTVMTPPAVSKPRERGVTSNRRRSWTFSLPSPL

Sequence

>CNT30697339
GTCCGCTGCCGGGAGCTTCGAGGCGATCTTCTCATCCTTGATGGTGTTGCGCATGTTGTAGGCGTAGTTCTCCAGCGCGTTCTTGGACTCCACCTTCTTC
TTGTGCTCCTCATCCTCTGACTTGTACTTCTCGGCCTCCTGGACCATCTTCTCAATCTCCTCCTTGCTAAGCCTGCCCTTGTCGTTGGTAATGGTGATCT
TGTTCTTCTGCCCGGTGGTCTTGTCCTCAGCAGACACGTTCAGGATACCATTGGCATCAATGTCGAAGCAAACAGTGGAGAAGACCTGCTCCTTCTTGGT
GGGAATGGTGGTGTTCCTTGGGATCAAAACGGTCATGACACCACCAGCAGTCTCCAAACCGAGAGAGAGAGGGGTAACATCCAACAGGAGGAGGTCCTGG
ACCTTCTCGTTGCCCTCACCACTC