Detailed information on CNT30697275


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT002489, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30371243Oryza sativaOryza glumipatula49.7175.8796.05937forward
CNT30100442Oryza sativaOryza rufipogon49.2327.4697.41928forward
CNT30593965Oryza sativaEragrostis curvula3.0220.2894.7457reverse complement

Expression of CNT30697275

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MLLIRVSTHIQIHDVIHVSLFRMFCLHYSRTMRSHGSAIWIFIHDP*

>peptide 2 (52 aa)
RFSCSPSRRTSYALPPPLLFLSSPAPPLVQPSPIATVVVVRSRSLVSYCCFC*

>peptide 3 (54 aa)
MAMTLCYLFVFRPIFKFMTLFMFHYSGCSVYIIQEPCVAMGVQFGSLFMILEKR*

>peptide 4 (45 aa)
DSPVALAAAPPTLCRRRCCSSLHRRRRWCSRRRSPQSSSSAAGRW*

>peptide 5 (37 aa)
MVWIVWFISVLTFLITACRDVRIFRGDSTKISNNFRT*

>peptide 6 (31 aa)
MHKSCVCFTSSRLYLLSILYSLLCLIWFLGT*

Sequence

>CNT30697275
GCGATTCTCCTGTAGCCCTAGCCGCCGCACCTCCTACGCTCTGCCGCCGCCGCTGCTGTTCCTCTCTTCACCGGCGCCGCCGCTGGTGCAGCCGTCGCCG
ATCGCCACAGTCGTCGTCGTCCGCAGCCGGTCGTTGGTGAGCTACTGTTGTTTCTGTTAATTTCCCTGCTGCTGCCGAACCTTGCTGTCGCCGATCTGAT
CTCTTCCTTGCTGGTGGTGCACGGCTTGCTGTTGCTGCCGATATTCGTTTCTGCTGCTGCTGCTGTTGGCCTGCAACGAATAGGAAGGAGGCAGAGAAGG
CAGAGAAGAACAGGAAGGAAGGAAAGAAGGGGAAATTTGATAGAAGAAGGGAAATTTGGGGAATTTGGTGAATATTTCCAAATTCTTCGTTTTTCTTATA
CATTAGTACTGCTAGGTGTGGAGGGTTCCAACGTTGGAGGAGTTGAGTCGGAGTATCGAATGAGTTAAGGCAAGTACAAGACGGACTTATGTGATGGACA
AAACTGAGTTGTTTTGTTTGGCTTTACTTGCATAATTATTATTCAATTGCTTGTTATTACTGATTGTATGGCTATGACATTATGCTACTTATTCGTGTTT
CGACCCATATTCAAATTCATGACGTTATTCATGTTTCATTATTCCGGATGTTCTGTTTACATTATTCAAGAACCATGCGTAGCCATGGGAGTGCAATTTG
GATCTTTATTCATGATCCTTGAGAAGCGCTGATCACGCTTGCTTGGCTTACCGGTAATGCTAAGAGGATATTCACACCTGCCCGGGAGGGAACTACTATC
TTTTGACTTCTTTGGTTTAAAAATAAAGTAAATCCAACCCTTCATGTTGGTTTCTTAATGCATAAATCATGCGTATGTTTTACTAGTTCAAGATTGTACT
TGCTGAGTATTCTTTACTCACTCTTGTGTTTAATTTGGTTTTTAGGTACCTAATGACATCGATCGGCATGGGGCGGGAGTAGCACCCTTGGACTACACAT
TATTATTGCACACAATTGAAATTAGTTTTAGACTATAATTTTTGCTCAGCATAAGTTTTGCATAGAACTTGTAAAGGTCATTTAAGGTTCTGATCCTTAT
TTTTCACGTGGGATTTGTGGAGCTAGGATGGTTTGGATTGTGTGGTTTATATCGGTATTGACCTTTCTTATAACTGCCTGTCGTGATGTCCGTATTTTTA
GGGGAGACTCTACCAAAATTTCTAATAATTTTAGGACTTAGTTTTTGAGTGTATTTTGGTGTGGCATTTTAGGTACGTGGTTACCTGGGGTGTTACATCT
TATGTGAGTTTGGTTCGTGGCTTTAGGCTACCTACCTCATGTATAAATAGAGAGGGAGCGTGAGGCCTCCCGGTATCGCTTTTGAGAGTATTGAGTTGTA
AGTTTAGTTAGGGTTTCGAGTTTAGTCGAGATTTTCATGAGGAGTGCTATTGTTGAACTTTTTAAACAGATACTTGGATTACCAAATTTGGTCATTAACA
AACATAGAGAGAAGTAATAAAGTTGTCATCTACATCAAAAGTTCTTCCATTTGTGTTTGCTTGTGTTTGGCGGTCTAACCAGCGAGACACCGACGGTTAG
ACCGGCGGCATCACGGCGGTCAAACTGGCGAGTCACTGACGGTCAGACCGGCGGCGACTTCAGGCACGGCAGCTGATCTCGCGGTCCGACCGGAGAATCA
ATCTCGGTCAGACCGACGGTTTCCAGGTGATCAGACCAGCACGACTACTTCGGTCAGACTACGATTCATCGAATTTGAGGGTAACTTTTAATTCCGCTAA
AAGTTTTGGTTTTTGGGTACACCAACCATTCACCCCCCCTCTAGTTGGCTTAGTTCTTTCTATTCGATTCTACAGTCATCGTATA