Detailed information on CNT30697171


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30297025Oryza sativaTriticum aestivum36.1347.3588.8125forward
CNT30223766Oryza sativaHordeum vulgare41.6229.6992.36144forward
CNT30663056Oryza sativaTriticum dicoccoides20.8129.2797.2272forward
CNT306938Oryza sativaZea mays21.399.3298.6574forward
CNT30353505Oryza sativaEragrostis tef21.399.2597.374forward
CNT30581942Oryza sativaEchinochloa crusgalli21.3915.9110074forward

Expression of CNT30697171

Peptides detected in this lncRNA

>peptide 1 (48 aa)
WSFLSEDQNEQVFKFISQLDDNLHVHLTHSSTLLKLLPSSSRVRLKLT*

Sequence

>CNT30697171
TGGTCCTTCCTATCAGAAGATCAGAATGAACAGGTTTTCAAATTCATCTCCCAACTCGACGATAATTTACACGTACATTTAACACATTCTTCCACCCTTC
TCAAACTCCTCCCTTCTTCTTCCCGGGTAAGATTAAAATTAACTTGAGGCCAGCCAGCGTCGCCGGCGGCGAGATGTTTACAGGCTGGGCGTCCTCTCGG
CGGCGCCGGAGATGACGGTGAGCAGGTTGTTGCCGAAGGGGTCGCTGAGGTTGATGGGGATGCTGTTGCCGAAGTAGTTGAGGGTGTTGCCGTCCAGGAG
GAGGGCGCCGGTCTGCATATACCATGAGTGAGTTCACTTCAGTTCA