Detailed information on CNT30697144


BLAST search results

BLAST vs Swiss-Prot:
sp|P10707|CB2D_SOLLC, E-value = 4e-26

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30184672Oryza sativaSecale cereale17.1242.1293.53139forward
CNT30390869Oryza sativaTriticum turgidum20.0734.6894.48163forward
CNT30555402Oryza sativaOryza glaberrima60.3460.9597.55490forward
CNT30135675Oryza sativaLolium perenne20.9444.8590.59170forward
CNT30597113Oryza sativaOryza meridionalis46.185095.2375forward
CNT30371307Oryza sativaOryza glumipatula101.1175.8197.32821forward
CNT30481599Oryza sativaChara braunii12.5622.9787.25102forward
CNT30322408Oryza sativaAsparagus officinalis22.1720.7182.78180forward
CNT30151052Oryza sativaBrachypodium distachyon13.9248.7192.04113forward
CNT30104243Oryza sativaOryza rufipogon54.5682.0497.29443forward
CNT30578138Oryza sativaOryza barthii100.7497.597.07818forward
CNT30117952Oryza sativaOryza nivara100.8665.8996.95819forward

Expression of CNT30697144

Peptides detected in this lncRNA

>peptide 1 (46 aa)
FLSEDQNEQVFKFISQLDDNLHVHLTHSSTLLKLLPSSSRVRLKLT*

>peptide 2 (68 aa)
MKNPSMENMASRPFLISFTFSSAAWSGSLASPSGSNGPPGWSLSSRSCTTIAIAGESPVSISEQNQQV*

Sequence

>CNT30697144
TTCCTATCAGAAGATCAGAATGAACAGGTTTTCAAATTCATCTCCCAACTCGACGATAATTTACACGTACATTTAACACATTCTTCCACCCTTCTCAAAC
TCCTCCCTTCTTCTTCCCGGGTAAGATTAAAATTAACTTGAGGCCAGCCAGCGTCGCCGGCGGCGAGATGTTTACAGGCTGGGCGTCCTCTCGGCGGCGC
CGGAGATGACGGTGAGCAGGTGCTTGGAGAGGTTCTCGACGGGGCCCTCGCCGGTGACGTAGGCCTGGATGAAGAACCCCAGCATGGAGAACATGGCCAG
CCGCCCGTTCTTGATCTCCTTCACCTTCAGCAGCGCCGCCTGGTCCGGGTCGCTCGCCAGCCCCAGCGGGTCGAATGGGCCACCTGGGTGGAGCTTGTCC
TCCAGATCCTGCACCACCATCGCCATCGCCGGCGAATCTCCGGTGAGTATCAGCGAGCAAAATCAACAAGTGTAGACTAACTAAGGTCCCGTGTTTGAGT
TCATCGAAGATAAATTAAGGGTACTTCAAATGAGAAAGCTATTAGCGTTTGATTAATTGAGTTCTAATTACTTTAAGTTTGAAAGAGGATTTAAAATTTT
TATATAAAAAGTTCTCGTACGAAATACACCATTCAACAAATTGGAAAGCGTGCTACCGGAAACAAAAAAAATGTAAGACTAATTAAGTTTTAATTATTTT
AGATTTGGAAAAGGATATTTTAAAGCAATTTTCATATACAAAGTTTTCGTACGAGATATAGCATTTAATAAATTGGAAAGCGTGCTACCGAAAACCAAAA
GGTGTAAGAGTA