Detailed information on CNT30697113


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT306987Oryza sativaZea mays7.7627.7284.8125reverse complement
CNT30597089Oryza sativaOryza meridionalis19.7541.1496.86318forward
CNT30498583Oryza sativaDigitaria exilis6.5222.2990.48105forward
CNT30117889Oryza sativaOryza nivara15.7844.96100254forward

Expression of CNT30697113

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MQQKGWCCVQKGGDCGGRLWRERRASLNGWK

>peptide 2 (30 aa)
IQTLGPSYQKIRMNRFSNSSPNSTIIYTYI*

>peptide 3 (33 aa)
MSGLEEVGDAAEGVVLCSERGRLWWAFVERKES*

>peptide 4 (52 aa)
MRSPNFICTLFSPLISQLMLQCLQPVLAFHLVSNSQLVLPTKRSGFFPHKKI*

>peptide 5 (59 aa)
MFTTCTSISPGFKFPTCTAYKKVWIFSTQKDLNFFLETTAKDSEKWELVTYSPGTSPLR*

>peptide 6 (52 aa)
NPNTWSFLSEDQNEQVFKFISQLDDNLHVHLTHSSTLLKLLPSSSRVRLKLT*

Sequence

>CNT30697113
AAATCCAAACACTTGGTCCTTCCTATCAGAAGATCAGAATGAACAGGTTTTCAAATTCATCTCCCAACTCGACGATAATTTACACGTACATTTAACACAT
TCTTCCACCCTTCTCAAACTCCTCCCTTCTTCTTCCCGGGTAAGATTAAAATTAACTTGAGGCCAGCCAGCGTCGCCGGCGGCGAGATGTTTACAGGCTG
GGCGTCCTCTCGGCGGCGCCGGAGATGACGGTGAGCAGGTTGTTGCCGAAGGGGACGACCTCGGCGGCGACGGCGACGATGAGGTTGATGGGGATGCTGT
TGCCGAAGTAGTTGAGGGTGTTGCCGTCCAGGAGGAGGGCGCCGGTCTGCATATACCATGAGTGAGTTCACTTCAGTTCAGAGATTCAGGTATTGAGCTT
GAGTGATCAGCGAATTAGCTGAATTGCCGATGATCAGTGGCTAGTACACGCACCTTGAACCAGACGGCCTCGGGGCCGCAGTTTGCGCCAAACTTGTTGC
AGGCCTCGGGGATGATGAACCCAGCGGCGCCGAGCATCGCCCACCTGGCATGGATCAGCTCATAGGCCTGGTACCTGCAGGGTGAAAATTTTGTCAGATT
TTACTCAGATACAAGAATCTGAAAATTTGAGTCTGAAAAGAAGAAGAATTTGAGGATTGAACGCTGCTACTTACTTGGAGAAGTCCTCTGGCTTCTTGCT
GAGGCCAAAAGGGTCGTAGCCGTAGCTGCAAGTTCAAAGGGCATGATAATTTAGTTTAGTTGCATTAAGAAACCTACATTTTCATGAGCATTTTGTTCAT
GTTGGTGTGCTATTAGTGGAGTGGCAACATCATGCTACTTGTACAACTAAAAGTGAAGAACAATATCGAACTTTTGGTAGGTGAAAATTGCTCTTTAAGA
TTGGGGAATTGAGCACCTGAAAATTCAGATGCTAGTTTGTTTCAGAGATAGTCCGTGCTCTTTTGATTTTATGGAACAGCTAAACTAAACAGCAATATTT
TCCTATACAACATGAAAACAAAATGCAATTCGGGACAAAACTATTCCTTCTCCAATGAGAAGTCCTAATTTCATTTGTACTCTATTTTCTCCACTAATTT
CCCAGTTGATGCTACAATGTTTACAACCTGTACTAGCATTTCACCTGGTTTCAAATTCCCAACTTGTACTGCCTACAAAAAGGTCTGGATTTTTTCCACA
CAAAAAGATCTAAACTTTTTTCTTGAAACTACAGCAAAAGACAGCGAAAAATGGGAGCTTGTGACTTACTCTCCGGGGACCTCTCCGTTGAGGTAGTCCG
GCACCTCTGAGCGGTCCAGGAGACCCTCCGGCAAGAAGATCCTCCTGTCAGGGCCTGACAACAAAAACAAGGCAAAATTTTCAAACCGACAAGATTCTGA
ATTTTACATTTAAAAATTTCTTGGAACACAAAATTTTCAGCCGTCAGATTTAGCAATTTCACTCACCGTACCACTTGGCGAGCTCATCGCCGATGTCGGG
GCTCGAGGAGGTGGGAGATGCAGCAGAAGGGGTGGTGCTGTGTTCAGAAAGGGGGAGACTGTGGTGGGCGTTTGTGGAGAGAAAGGAGAGCTAGTTTAAA
TGGATGGAAA