Detailed information on CNT30697003


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30103923Oryza sativaOryza rufipogon60.6410099.83604forward
CNT30578339Oryza sativaOryza barthii52.4199.8194.06522forward
CNT30117663Oryza sativaOryza nivara32.2398.4799.69321forward

Expression of CNT30697003

Peptides detected in this lncRNA

>peptide 1 (58 aa)
MTRFSQTTSYLRMASQVTHTRGLVMVILPFELLPRTIVRHLLVPICHVLEVMYSFCPL*

>peptide 2 (42 aa)
RRSKLSRHSFNFFPIAYQYEECPFTRNPADDDGACYRRPRSV*

>peptide 3 (73 aa)
MKSALLLVILLTTTALATGVLAAYNDPLQPDYLLPSDGKPGYPYTRFSNGDPSIRASSPYHRPSPPCSHLPCP*

Sequence

>CNT30697003
CGAAGATCTAAGCTTAGTAGACACAGTTTTAATTTCTTCCCGATAGCATATCAGTATGAAGAGTGCCCTTTTACTCGTAATCCTGCTGACGACGACGGCG
CTTGCTACCGGCGTCCTCGCAGCGTATAATGACCCGCTTCAGCCAGACTACCTCCTACCTTCGGATGGCAAGCCAGGTTACCCATACACGAGGTTTAGTA
ATGGTGATCCTTCCATTCGAGCTTCTTCCCCGTACCATCGTCCGTCACCTCCTTGTTCCCATTTGCCATGTCCTTGAAGTGATGTATTCCTTTTGTCCTT
TATAGTCTTAAAATATATTACATCTATACTAGATTGTACTTATATATTAGAATGAAAGGAGTAATGGTCACATTTTAAATAGAAGATTAGTTTGTCGAAG
GAAAAATGACATTTATTAGGCTTGTATGCTTGTACTTATAATAAAGTACTTATATTGGTGCAGTGTAGTGCAAAAGTTATCAACAAATATAATAAAATAG
TTTTTATTTCTTTGAGAACCACAGATTAAATAAAGGATGTCCTTCTGACTTTCTTTTTGTCCCCCGTCTTGTCCCCTTCTCCCCAAGGCCATGACTACGG
CAACCAGGCAATTTTCCATGTGTTAGTTGTTTCTTTTTTATCAAACATTTTTTATGAAAAAAATCTACTAAATTTCAGCTCAGCTCCTTTTAGATCTAGC
CCTCACATTTATGTACGTTAAAAACTTAGGTACATTACCACCTTAAAAAGAAGATGTTCAACCGTATAGGTAATTTAGGGGTCGAGATCATCTGATGTAG
AGAATTCTACGTCAGAGGGACGTCCTGCCTCGGATCACCGTCCCTAACCGCATCAAATGGCAGCACTTGTTTCGCTCCCACGGCATTGAACTCTGGCCGC
CGGATTGCCAGAGCCGCTGCTCGACCAACTCCTCTCTCGCTGGCGAATCGTGTGCCCCTATGACATTAGCGGTTCCAGCTCTAGCTGATGCGGGAA