Detailed information on CNT30696990


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676219Oryza sativaSetaria viridis16.7659.6795.86145forward
CNT30377016Oryza sativaArabidopsis thaliana9.622.884.3483forward
CNT3068331Oryza sativaLeersia perrieri18.7321.1298.77162forward
CNT30371334Oryza sativaOryza glumipatula43.744.63100378forward
CNT30570222Oryza sativaVitis vinifera12.0220.8482.69104forward
CNT30578122Oryza sativaOryza barthii49.9454.82100432forward

Expression of CNT30696990

Peptides detected in this lncRNA

>peptide 1 (69 aa)
TRIIPESQACIYTQNFAVTKSIHRPHIQVVYRFVYTQGYCRGKTRGMYIKRSRKDSCDEIHDEPRMFSR*

>peptide 2 (63 aa)
MPSLASAASPSLVYLPSCASELALARRSSAFCVASTSDCPPDKNCTKQQSINIIDQLYFQVYS*

>peptide 3 (57 aa)
MQYSFNFVHRSQPVTVTTHWLQCPRGTSSIAVAVVRSSSSSRFTVLIGLDRISRRSS*

>peptide 4 (51 aa)
QNNSRITSMYIYAKLCSNQIDSQATHTGSIQIRLHTRLLQRQNTRYVYQTL*

Sequence

>CNT30696990
ACCAGAATAATTCCAGAATCACAAGCATGTATATATACGCAAAACTTTGCAGTAACCAAATCGATTCACAGGCCACACATACAGGTAGTATACAGATTCG
TCTACACACAAGGTTATTGCAGAGGCAAAACACGAGGTATGTATATCAAACGCTCTAGAAAAGATTCATGTGATGAAATACATGATGAACCACGTATGTT
CTCAAGGTAAAATTAATTAATGCAGTATAGTTTTAACTTTGTCCATCGATCTCAACCTGTAACTGTGACGACACACTGGCTACAGTGCCCTCGAGGTACT
AGCAGTATAGCAGTAGCTGTAGTACGTAGCAGCAGCAGCAGCAGGTTCACTGTCTTGATTGGATTGGATCGGATTAGTAGACGTAGTTCTTGACGAACAT
GCCCTCCTTGGCCTCGGCGGCCTCGCCGTCGCTGGTGTACTTGCCGAGCTGCGCCAGCGAGTTGGCCTTGGCGCGGAGGAGCAGCGCGTTCTGCGTCGCC
TCCACCTCCGACTGCCCACCCGACAAGAACTGCACCAAACAACAATCAATCAATATTATCGATCAGCTCTACTTTCAGGTTTATTCTTGATCATCTACAT
CTGCAGAGACAGTTAGTAGTATCGTTGTGCAAGAAGAATCATGTCAGAATTAGCAGATCAACATTTGCAGTGGCAGTTTCTTGATCAACATTTCCAGTCA
GGTTAAGCCATTTTGCAAGAAGAATCAGGTTAAGCTTTTAACATTTGCAGCGGCAGTTTCTTGATCAACATTCCAAGTCAGGTTAAGCCATTTTGCAAGA
AGTAAAGCAATATTAGTAGCTTCCTAAGCTTTAGTTTCAGTTTCTTTATCAGTGGTAGAATGCTG