Detailed information on CNT30696945


BLAST search results

BLAST vs Swiss-Prot:
sp|Q94BZ1|ZIFL1_ARATH, E-value = 3e-20

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3067307Oryza sativaLeersia perrieri10.3838.0889.03155forward

Expression of CNT30696945

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MSSSVCATCRSLTYENRGQNKLAYLICQKWRVW*

>peptide 2 (38 aa)
MIKANHNSFIMVHIERIVEHNGENKIVACEITMESPRA*

>peptide 3 (48 aa)
MTGFLPIRSATTPQKIAAKDLPTINYTEKSSIIPNVLLCLCYLQVPYL*

>peptide 4 (50 aa)
MLILSLGRLLSTFIGASKPFRAPRTNLVVSAIQYFVLSPNSVLNMTLQQY*

>peptide 5 (40 aa)
MKMKCLMNSSEYIYINLYGGREMAIYLQQQELDQYPQMKS*

>peptide 6 (43 aa)
MFMYSLTGSQIQLIRTIAANNDTPRQGKRYGNLQNVMKLDMGS*

Sequence

>CNT30696945
AGAACTCCTCCCCCTACTGGAGCAATTGCCTTGAAAAATGACATAGCTGTTGTTGATACACCATTTGCAGTGCCTCTATGTTCTTGAAGCTGATATTGAA
TTTCAAAGAAGAACTTTGAAAATGCTTACTGCAAGAGCACTTTTCATCATTGCCGCTGAATAAAGAGCAAACGAAAGTCCCGTGCCAGAAAGGTATGTCA
TAAAAGGATAAGTAGAAAGAATAAGTATAGATAGAGCCTGCAATTTCAGTAAATATGAGTGATGAAGATGAAATGTCTCATGAATAGTTCAGAATATATA
TATATAAATCTGTATGGTGGGAGGGAGATGGCAATATACCTGCAGCAGCAAGAACTTGACCAATATCCTCAGATGAAAAGCTAAGGCCACCATATTTTCT
ATCACTCACAGCCCACAAGGATATATGCTTCTTTACCTCACTATATGCTGTGTCATGAAGACCAAAAAAACAATATGAAATCATAGTAGACATCCATGGC
CAATTCTGCAACAAGCTTTTCTTGCGAGGTGAATCCCAATAAGCCTGCTGTAATGGCAATTCTTTGATTCTTTTGATGTCCTTTTCAGGAGATTTATGTT
TATGTATAGTCTTACCGGAAGCCAAATACAACTTATTAGAACAATAGCAGCAAACAATGATACACCAAGGCAAGGTAAGAGATATGGAAATCTGCAAAAT
GTAATGAAATTAGATATGGGTAGTTAGTATACCTGTGCAAGGTAGCCTCCAAGAGCTGGACCAACAACCAGACCCAAACCCCATGCTGTGTTAACCTATG
ATCAAAGCAAATCATAACAGCTTTATAATGGTGCATATTGAAAGGATTGTGGAACACAATGGGGAAAACAAAATAGTTGCTTGTGAGATTACAATGGAGA
GTCCAAGAGCTTGATGTTCAGTTTGGCAAACTTCAATAGAATAAGCCTGTAATGGTTGATAAACACTGTCAGCAAAGCTCCCTCCTAGGCACATGAATAA
TGTTGATATTATCACTTGGAAGACTTTTAAGTACCTTTATTGGCGCAAGTAAACCATTTAGAGCACCTAGAACAAATCTTGTAGTAAGTGCCATCCAATA
CTTTGTACTTAGTCCAAATAGTGTGTTAAATATGACCCTACAACAATATTGAAAACATAATGACAGGTTTCCTTCCTATACGATCTGCCACAACACCCCA
AAAGATCGCGGCAAAGGATCTACCGACCATAAACTATACCGAGAAATCCAGCATAATTCCCAATGTCCTCCTCTGTTTGTGCTACTTGCAGGTCCCTTAC
CTATGAAAACAGAGGACAGAATAAGCTAGCCTATTTAATATGTCAAAAGTGGCGAGTGTGGTAACGGCGACGAAGAAGAGCTCCGTGTAGGGGATCCGCC
CTCCGCGCCTCGCCTTCCTCTGCTCCTGCACGCACCCCGGGCACCTCTCCTCCGCCGCCGCCGCCGCCGCCGGCAGCAGCAGCAGCGGCGCCG