Detailed information on CNT30696872


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30696872

Peptides detected in this lncRNA

>peptide 1 (57 aa)
MKTTNKNSSHSLSLPYGYESMLKNLHVLYKLSFTSQLVSLFITTLQDHLPPKMHRTL*

>peptide 2 (38 aa)
PPQIVEKAHQVYEQLIIHNRMHYQLNYVLMAQILGVMY*

>peptide 3 (42 aa)
MLHTYSNLLQKICHYPLQKACPCVDEVHVDSSPNLTKPSPLY*

>peptide 4 (35 aa)
MGQGPMPAAAPLLLLLLQLMFAAWEKVHFDSLKYR*

Sequence

>CNT30696872
CCACCGCAAATCGTGGAGAAAGCACACCAAGTATATGAACAATTAATTATACACAACAGAATGCATTACCAGCTTAATTATGTACTTATGGCACAAATAT
TAGGAGTTATGTATTGAAAAAACACTGAACATGAAAGTAGGGGTTCTCATATCGGAATTTGTTGAGAAAAACGAGGCTTGAACTTGAGCTGGCTAGCTGA
TCTCTGGTGCTAGCCTGAAGACCTCCAGACCTTTTCTCAAAAGTTCTGTATTGGGGCAGTTTGTCATAAACAGCTAACTTATACTGCACCATTTTACTGG
ATTAAGGAAGTCGTTGCTAACTTATATTCATAATTAGAACTCGTCCGCGTCTACCGGCTTGTGACCAGTGTTCCTTTTTGCCGGGCCATGACCGTGACCA
GTCTTCTTTAGGGGCAAGGGTAGTAAGTAAATTTCATCAGGGCACCAGTCTTGGCTAGAAGTTGATGCTTCATACATATTCCAACCTTCTTCAAAAGATA
TGCCATTATCCATTACAAAAGGCATGTCCATGTGTGGATGAAGTACATGTGGATTCATCTCCCAATCTGACGAAGCCATCGCCGCTTTATTAGAAATTCC
CTGCGTAAAATGACGTCGGCGTAAGCTGTGCTGGTGCGCCAACCTTGGGCTCAGCAGGCTACACTTACTAAATCATGTTGAATTTAAGATTACGTGGAGA
TATTATTGATGCATAAAAAAATATTTAAACGCAAATGAGTCGGGCGATATAAATTGAACTTGAAGCATACTGGATGCTAATTAAGATATAGACCGAAATA
ACTAAATTAATTCTCAGTTACTGAAAACAACTAATTACTAGGACTACTTATTAGCTATTACAAAGAGGACAAATTTTACTTAACAAAGGCAAGTTGCTAT
CTGAAATCCAAGAATCTTCCATACACAATCCTGAAATGAAAACAACAAACAAAAACTCCAGTCACTCTCTGTCCCTTCCCTATGGCTATGAGTCAATGCT
CAAGAATTTGCACGTACTTTATAAATTATCGTTTACCTCTCAATTAGTATCTTTGTTCATTACCACTCTACAGGACCATTTGCCGCCAAAAATGCACCGT
ACCCTATAAGTTCTTTCTAATTCTGTAGCCAACTTACTGTAAGATTTTATTATCAAATCTTGGACCATATATATGCCTATACTGCAACACTCTTTTTGTT
TTCGTCAAAAAAATTGATCTGATGTACTAGTGATCGGGCATTCACCGTTATAAATTACTCCTCGCCTCAAACCACCGAGGTGGTACTAAACTTTGCCACA
ATATACTTCTGCTGCTGGCTGTTGCCGATCTGCTGCTGCTCGCGAAATGGGCCAAGGCCCAATGCCCGCTGCTGCACCACTACTGCTCCTGCTGCTGCAA
TTGATGTTTGCTGCCTGGGAAAAAGTCCACTTTGACTCCCTTAAATATAGGTAAAATCTAATTCGTA