Detailed information on CNT30696855


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30677344Oryza sativaSetaria viridis30.9225.3689.72107forward
CNT30297383Oryza sativaTriticum aestivum23.9914.9890.3683forward
CNT30223563Oryza sativaHordeum vulgare23.9916.990.3683forward
CNT30392240Oryza sativaTriticum turgidum23.9910.490.3683forward
CNT30555309Oryza sativaOryza glaberrima97.6967.297.63338forward
CNT30439260Oryza sativaAegilops tauschii20.5211.8188.7371forward
CNT30662523Oryza sativaTriticum dicoccoides23.9912.7790.3683forward
CNT30463176Oryza sativaSaccharum spontaneum22.5413.9594.8778forward
CNT30135612Oryza sativaLolium perenne21.9712.0390.7976forward
CNT3068314Oryza sativaLeersia perrieri24.869.4395.3586forward
CNT30683568Oryza sativaTriticum urartu23.9916.990.3683forward
CNT30338280Oryza sativaEragrostis tef26.316.9891.2191forward
CNT30367417Oryza sativaSorghum bicolor25.7231.993.2689forward
CNT30371358Oryza sativaOryza glumipatula55.231.47100191forward
CNT30105156Oryza sativaOryza longistaminata28.3218.2290.8298forward
CNT30104073Oryza sativaOryza rufipogon71.130.48100246forward
CNT30578155Oryza sativaOryza barthii71.122.3696.75246forward
CNT30117901Oryza sativaOryza nivara10058.05100346forward

Expression of CNT30696855

Peptides detected in this lncRNA

>peptide 1 (76 aa)
MQKKTNYYTHKSTTRRPATYGEVVAAAGDVVMRSISRRGGASSRRWTPRRSCGPSSSRGARGRRGGGASPPPWLIN*

>peptide 2 (48 aa)
SLSLVEAGDSCEKQQHHACRRRQIITHTNRRHGGRRRTARSSPPPATL*

>peptide 3 (92 aa)
ASHWSRPETLVKNSNTTHAEEDKLLHTQIDDTAAGDVRRGRRRRRRRCDEVDQPKRWCFFSPVDSSALLWSFFFSWCSWKAWWWCFSSAMAN*

Sequence

>CNT30696855
CAGCCTCTCACTGGTCGAGGCCGGAGACTCTTGTGAAAAACAGCAACACCACGCATGCAGAAGAAGACAAATTATTACACACACAAATCGACGACACGGC
GGCCGGCGACGTACGGCGAGGTCGTCGCCGCCGCCGGCGACGTTGTGATGAGGTCGATCAGCCGAAGAGGTGGTGCTTCTTCTCGCCGGTGGACTCCTCG
GCGCTCTTGTGGTCCTTCTTCTTCTCGTGGTGCTCGTGGAAGGCGTGGTGGTGGTGCTTCTCCTCCGCCATGGCTAATTAATTAATTAAGCTAGCTAGAA
GCTAGTGATGACAATTAGGAGAATGAGATGGAAGTGACAATAAGAT