Detailed information on CNT30696799


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30116863Oryza sativaOryza nivara94.2799.6799.092419forward

Expression of CNT30696799

Peptides detected in this lncRNA

>peptide 1 (69 aa)
PTQAKAQQSITHLAHLHPLLSFSSSLPLPHASPQRRRSHCRSSSRRPLLPASGSRPAAAAGLNRFRGSS*

>peptide 2 (53 aa)
MRIFFSTDIEITKTGLVLFYSYAMVIKILNFLHATILAQSDPYILMLSSNSEN*

>peptide 3 (43 aa)
MYLYTCYSSNPTDSVLLYEELNTLVSFETASLLVFLTVAYDLY*

>peptide 4 (40 aa)
MCSCLPKCIYVIILDKLKCFLLLTPNNYKLELTYIYFSVK*

>peptide 5 (39 aa)
MSLPPKLTVAINPSPVSNRFCCWLLLSMTEIEISQPQRP*

>peptide 6 (30 aa)
MNFYTCEQVLITNWMVLFLLSVGSILFDLL*

>peptide 7 (32 aa)
MHAQMNQVCAFFLVLILKSQKQDWSFFILMQW*

>peptide 8 (30 aa)
MILGDNYMVPFSGSAATLLDSDSMVLPMEL*

Sequence

>CNT30696799
GCCCACACAAGCAAAAGCCCAACAAAGCATAACCCACCTAGCCCACCTTCATCCTCTTCTCTCTTTTTCTAGTTCTCTTCCTCTCCCTCACGCTTCTCCC
CAGCGCCGCCGCTCACACTGCCGCTCCTCCTCACGCCGGCCGCTGCTCCCTGCCTCCGGCAGCCGCCCCGCAGCCGCTGCCGGCCTGAATCGGTTCCGTG
GCTCCTCATGAGTCTACCCCCCAAGCTAACCGTAGCCATCAACCCCTCACCAGTCTCCAATCGATTCTGCTGCTGGCTACTGCTCTCAATGACTGAGATT
GAAATTTCCCAACCCCAGCGCCCCTGATTCAAGCGTGGCTCAGACCAGCCGTCTCTCCCTCCCCGAGCTCCTCCTCTCTGATCCCCTTCTATCCCTACTT
CTGTGACGTGATCTGATTGGTTGTTCTCTTAGGTGGTAATCTACGATGAATTTTTATACTTGTGAACAGGTTCTAATAACCAACTGGATGGTGCTATTCC
TGCTATCTGTAGGTTCTATATTATTTGATTTGCTATAATTGGATGATGACTATATGCTATGGATGAATGAGTGAATGCATGCTCAAATGAATCAAGTATG
CGCATTTTTTTTAGTACTGATATTGAAATCACAAAAACAGGATTGGTCCTTTTTTATTCTTATGCAATGGTAATCAAGATACTGAATTTTCTACATGCCA
CTATACTAGCACAATCAGATCCTTATATCCTTATGCTGAGTAGTAATTCAGAGAATTAATTTGAATTCCTGCATACCAAATGCATCATAGTAATATGACT
AAAATGATCACATGACCTAAAAACTATGCATCTTGATTTTGTTGTCAAATATACTGACTACTAAAATAACTGGTAATTAATTGTGTTCTATGTTATTGGT
CTTAGCAAAGTTATGCTGATCAACTACTAAGGTTCAGATCCTAATGTTATGCTCTTCTAGGACTTATGATTAGGACTCATAGATTTCTGTTTATGGATCT
ACATTTATACTAAAGATGTACTTGTACACTTGCTATTCATCCAATCCTACAGATTCGGTATTACTATATGAAGAACTAAATACATTGGTGAGTTTTGAGA
CTGCTAGTCTGCTAGTATTTCTCACTGTGGCATACGATTTATATTGATTAATACTTACAGAACTAATGTATGTCATGCTTTAATCTAGAATCATATGCTC
TAGATGCTCTGCTATAGAGACTTATAACCCTACTCATTAATTCTAACTATTTATAATTTCAGGATTCACCAAAGAGATGCATGTGCAGCTGTTTACCTAA
ATGCATTTACGTAATAATTCTAGACAAACTAAAATGTTTCTTGTTACTAACCCCAAATAATTATAAACTAGAATTAACCTATATTTACTTTTCAGTTAAA
TAAAAATATTTATGTCCTACTAGTTGCACTTCCTACTCTGCAGCTCAAATTACTTAATATTCTTGTTCATCTTCTAATGGATGCAAATGCAACTCACAAC
TCCTACACATACTAGTATATGCATCACTCAAGAATCATGTCATGATATGATTGTACTTTCAGTTTAATCTCTTGATTACCTGCCATGATTTTAGGTGACA
ATTATATGGTTCCCTTCTCTGGTTCTGCAGCTACTCTTCTGGACTCTGATTCAATGGTTCTCCCGATGGAACTGTGATTTCTCCTCTTTGAGCTGAAGCA
CCACCTGCTCCTCCAGAAACTGAAACCCCTCTCTTCTTGAAGCTCAGGTACCTCCTACTTGATTTGCACCCTTGCTACCGATTTCTTTGATTTCTTGTTC
TTGCTGATTTTACCTCCTGATCCAATTTACAACAGTTGCCTCTTCTCTTCCTTTCTTCTTGTCCTGCTTCTGCTGTTACTGATCCATCTTGTTTCTTGAG
CTGGAGTGCCATCTCCTCCTAGAGCTAAAATCCCTGTTCATGCAGGACTGAACACCTCTACTTCATCCAAGAACTAAATACCTTTGCTTCTCCTTCTTCA
GATTTGGTTTCTCTCTCTCTCTTTCTTGTTGTTTCCCTGTGGATAATAGGAATGAGATACGGTGTAATTGTGTTGCTGGCTACTAAGCTACTGCTCTGCT
ATTTTTCTCTGTTTTGAGCTGGTTTTACAACCGAACTGCTGGCTGCTACTACTGCTGCGGCTGAGGATGCTGCTTGGGGTTGTTTTCCAGCCGATGCAAC
CGAGACTGATTCACAGATAGCTGGTTAATATATGTGTGAATTTTTTTTGTGAAGGCTGGGTGACTCACCTACTTTAGTTTTGGTGGTTGTTTCACTGACT
GACACCTAAGCAGTGTTTGATCGGTGGTGTAATGTGGGATTTCACTAAATTTTTCTATTTAGATAAATTCTGATACAATTAGGTACTTTTGCACTTGAGT
CCCTCGGGGTCTCTAAAATTGAAGGTTACTCTGAGATTAGGGACTAATTTATAATTGTTCTAGAACTCATAGTCATTTTTGCAAGGTTACCAATTCTCCA
TATATTTTTGGTAGATAAATTTATGCTTCTATATGATGTAGCCGTGCATCTATTTGCTTGCTGGGA