Detailed information on CNT30696744


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT000163, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30696744

Peptides detected in this lncRNA

>peptide 1 (94 aa)
PRATVLLQAPAARAVLCAAASSVESFASRDPFAKLVEGKYSSYPPVSFPPRIRLYPEEINAESSSIRVYPSKLNPRFSRRDYLRSKPDLSLPWL*

>peptide 2 (53 aa)
MVGCEHMVLKVVLMTIKDRFASYCCETLTVPTTSQRGQRLYLLYSMVHYGVTD*

>peptide 3 (49 aa)
MSLGGVNLFLCYGQFALNTLFLDTLGNKLISLNLIYWFGSAKSYIDIYI*

>peptide 4 (40 aa)
MLILCLNSLFISTVHLFSNVIGWCEPIPLLWPICIEYPIP*

>peptide 5 (34 aa)
PVLLFFFKLQPPVPCSVLPLPPLNPSHPVIRLQN*

Sequence

>CNT30696744
CCCCCGTGCTACTGTTCTTCTTCAAGCTCCAGCCGCCCGTGCCGTGCTCTGTGCTGCCGCTTCCTCCGTTGAATCCTTCGCATCCCGTGATCCGTTTGCA
AAATTAGTTGAGGGGAAATATTCCTCTTATCCTCCCGTATCCTTTCCCCCAAGAATCAGACTTTATCCCGAAGAAATCAACGCGGAATCGAGCTCGATTC
GTGTTTATCCCTCCAAACTAAACCCTAGGTTTTCCCGGCGTGATTACTTGCGTTCCAAGCCCGATCTCTCTCTCCCGTGGCTATAAATAGAGTCCCCTCC
CTCTCCTCTTTCGTTTGCCACCCTCGCCTGAGCTCGCCGTCGCCCGTAGCGCCCTAGCCGCCTCCACCCTAGCGTCGTCGTCGCCGCCGAGTTTCCATCC
GCGCCGTGCCGTCGCCTCGGTCGTCCCCGACCTGTGCCGCCACCTCCCTCGGCATCGCAGCACCGAGGAGAAGCCCGTCCACCCCTCCGTTGTTGCCGCT
CGTCGCCGAAGCGCCACCGACGCCGTCAAGCCGAGCCCGTCGCCGCTTCAATCTCGTTGTCGGCCGTCTCCTGTCGTTGTTCGTCGTCGTGCCGCCCCTC
AGTGAGTTCCCCGCGTCATGCTCGTCGCGTTGGTGCCCTCCATTCTCACCGCCGTGACCTAGATCGCCGGTGACCGTGATGTCCCGAGCCTCTCACAGCT
TGTCGTTTCCGTCGATGCGAAGGCTCGTGAGTGCGTCGGAAGAGATTCAGAAGACTAATTGAAGACCGATTATTGCAAGGCAAGTCACACAGATCCCAAA
CACAATTCCTTTGAGCATGTTGATCCTATGTTTAAATTCTCTATTTATTTCAACTGTGCATTTATTTTCAAATGTCATTGGGTGGTGTGAACCTATTCCT
TTGTTATGGCCAATTTGCATTGAATACCCTATTCCTTGATACCTTAGGTAATAAATTGATTAGCTTGAACCTTATATATTGGTTTGGTTCAGCTAAAAGC
TATATAGATATATATATATAATTCCTTAGCCATGCTTAGAGACATTAGCTCATTAATGGGATGAATCATACTACATTATTACTTATGGTTATATTTAATG
GTAGCTCACGATGGTTAATCGTGTTATGATAATTAATTGATAACTAAAACTTGACAATGGTGGGTTGTGAGCACATGGTTTTAAAGGTCGTGCTCATGAC
AATTAAGGACCGGTTCGCGAGCTACTGTTGTGAGACATTAACCGTACCAACCACAAGCCAGCGTGGGCAACGGCTATACCTTTTGTATAGCATGGTTCAT
TACGGGGTGACAGACTGAGAAGCGG