Detailed information on CNT30696704


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30522415Oryza sativaSetaria italica49.0747.1688.61158reverse complement
CNT30727469Oryza sativaCorchorus capsularis27.6429.2888.7689reverse complement
CNT30307334Oryza sativaTriticum aestivum26.427.9692.9485reverse complement
CNT30561829Oryza sativaActinidia chinensis30.7527.7385.8699reverse complement
CNT30554032Oryza sativaOryza glaberrima31.9921.592.23103reverse complement
CNT30669640Oryza sativaTriticum dicoccoides25.7827.3992.7783reverse complement
CNT3061108Oryza sativaArabidopsis lyrata17.3924.4594.6456forward
CNT30445279Oryza sativaSaccharum spontaneum44.7224.6686.81144forward
CNT30130300Oryza sativaLolium perenne31.0634.691100forward
CNT3015222Oryza sativaZea mays27.3329.7392.0588reverse complement
CNT3067608Oryza sativaLeersia perrieri27.6428.995.5189reverse complement
CNT30652801Oryza sativaRosa chinensis24.5325.8288.6179reverse complement
CNT30339268Oryza sativaEragrostis tef65.5372.0185.78211reverse complement
CNT30361740Oryza sativaSorghum bicolor28.5730.1691.392reverse complement
CNT30596965Oryza sativaOryza meridionalis71.4364.0794.78230reverse complement
CNT30369610Oryza sativaOryza glumipatula26.420.7391.7685forward
CNT30644641Oryza sativaCannabis sativa26.0922.5889.2984reverse complement
CNT30105324Oryza sativaOryza longistaminata31.9932.2991.26103forward
CNT30150512Oryza sativaBrachypodium distachyon26.427.8794.1285reverse complement
CNT30103689Oryza sativaOryza rufipogon95.9679.2399.03309reverse complement
CNT30576754Oryza sativaOryza barthii31.9927.3992.23103forward
CNT30117631Oryza sativaOryza nivara95.6595.3699.68308reverse complement

Expression of CNT30696704

Peptides detected in this lncRNA

>peptide 1 (73 aa)
LKVDKWWSAMEGTWAGSGPGLQRPVILPPLEAGGTRCSVKPASRNTRHSRCRDARAFAQAPHTRYATWNGRAA*

>peptide 2 (38 aa)
SKLISGGLPWKALGPEAGQGCSGPLSFHRWKRAVLAAL*

Sequence

>CNT30696704
CTCAAAGTTGATAAGTGGTGGTCTGCCATGGAAGGCACTTGGGCCGGAAGCGGGCCAGGGCTGCAGCGGCCCGTTATCCTTCCACCGTTGGAAGCGGGCG
GTACTCGCTGCTCTGTGAAACCAGCCTCACGCAATACCCGCCACTCTAGGTGCAGGGACGCTCGAGCCTTCGCCCAGGCGCCCCACACACGCTACGCAAC
TTGGAACGGGCGGGCCGCATAGTGCAAACCACAGGCGCAGACCCCAAGCGCAAACGACCAGGCATCCAACACCACCTTATTGCCCCCGCTCGGGTGACAA
GCCAACGCTACCTGGCTCGGCG