Detailed information on CNT30696451


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6ENH4|PSAA_ORYNI, E-value = 0.0

BLAST vs NONCODE:
NONORUT000576, E-value = 1e-108

Expression of CNT30696451

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MKTPFFIEISFYTINFIVFTLQNTSKLKLN*

>peptide 2 (30 aa)
MGKYELRALGRFSSGKGEGEENSMNLSVFP*

>peptide 3 (30 aa)
MGLYEPPKYLSGHDQYPSWSYTYDLRSGKE*

>peptide 4 (31 aa)
MAGSGPFLKRCFYRIPIHNNFYFWFRRTNHH*

>peptide 5 (51 aa)
MLEENDSSKNFFVLNASYLEELATSTIFDGYRGIQSTNLMVVCYPNHSSQP*

>peptide 6 (36 aa)
MIPGGYLTCSPSPRPIAREAKTKICFIGYQTGTASK*

>peptide 7 (47 aa)
MKFLIRSSDLIYLINGSTTKPPFSEKGEWSYSNSKRFVIFNQFCASI*

>peptide 8 (39 aa)
MTIYSSNNTIPLFNRNSLYQITMVCKIHIEERTKNKKES*

>peptide 9 (42 aa)
MFPLAQAHRKGSENQDLLYRVSNGNCEQIKHLSKVLIQSHGL*

>peptide 10 (42 aa)
MLAKSEKTRRLFGFLGNPRLHHHSIFLALRLAKLPEHWVQCE*

>peptide 11 (42 aa)
MEVHATQPKKDNGELTEMSTKDFSRDLLQITCMTIEIVSISM*

>peptide 12 (39 aa)
MALSCKWAFMSLQNIFQAMTNTPVGPIHMTCDQEKNSNS*

>peptide 13 (38 aa)
MFLQDPYPQQFLLLVPANESSLSPPLSGQDIQRDPPTF*

>peptide 14 (35 aa)
MDRKGLVFFQEISSQPSHKRFFLTPMNSINARGKR*

>peptide 15 (34 aa)
MSYHPLITYSTPNIRLHFPTEMENDYRNGIVHPE*

Sequence

>CNT30696451
GGATAATGAAGAACCATAAGACTGAATTACTTGGGATGCCTGTGCCCACAAGAAATCTCGGAGCCACCCATTAATCGTAATGGAACTCTGTGCAAAGTTT
CCCCCTGTGATATGAGTTACCACCCCTTGATCACTTATAGTACCCCAAACATCCGACTGCATTTTCCAACTGAAATGGAAAATGACTACCGAAATGGAAT
TGTACATCCAGAATAGACCTAAGAAAACATGATCCCAGGCGGATACTTGACATGTTCCCCCTCGCCCAGGCCCATCGCAAGGGAAGCGAAAACCAAGATT
TGCTTTATCGGGTATCAAACGGGAACTGCGAGCAAATAAAACACCTTTCAAAAGTATTAATACAGTCACATGGATTGTAAATGCGTGAATGTGATGGACT
AAAAAATCTGCGGTTCCTAATGGAATAGGTAACAAAGCAACTTTGCCGCCTACTGCTACTAACTCGCCACCTCCCCACGTTAAGCTGGTACTTGTTGTTG
CACCAGGAGCTGTTACGCTAGGCGCGCCAGCATGGAGATTTTGTACCCATTGAGCAAAGATCGGTTGTATTTGTATGGCGGTATCCGAAAACATATCTTG
GGGACGACCTAAAGCACTCATGGTATCATTATGAATGTATAAACCAAAACTGTGAAAACCTAGAAATATACATACCCAGTTAAGGTGGGATATGATTGCA
TCACGGTGTCTAAGGACACGATCTAATAGATCGTTGTATCGAGTCGTTGGATCATAGTCTCTTACCATAAAAATGGCTGCATGTGCAGCAGCACCAACTA
TTAGAAATCCGCCAATCCACATGTGGTGTGTGAACAAGGAAAGTTGTGTACCATAGTCAGTAGCTAGGTATGGATAGGGGGGCATAGAGTACATATGATG
AGCTACAACAATGGTTGTAGAGCCTAGCATAGCTAGGTTAAGAGATAATTGAGCATGCCATGACGTTGTTAGAATTTCATAGAGACCTTTATGGCCCTGT
CCTGTAAATGGGCCTTTATGAGCCTCCAAAATATCTTTCAGGCCATGACCAATACCCCAGTTGGTCCTATACATATGACCTGCGATCAGGAAAAGAATAG
CAATAGCTAAATGATGGTGCGCAATATCGCTCAACCATAGACCGCCGGTTATTGGATCTAGCCCTCCGCGAAAACTAAGAAATTCTGCGTATTTGGACCA
ATTCAAGGTGAAAAAAGGGGTTGCTCCTTCGGCAAAACTAGGATAAAGTTGAGCCAAAAGGTCGCGATTCAAGATAAATTCATGAGGAAGTGGTATCTCC
TTAGGATCAACCCCAGCGTCAAGAAATTGGTTAATCGGTAAAGATACATGGATTTGGTGCCCCGCCCAAGAAAGAGACCCAAGTCCTAATAACCCTGCTA
AGTGATGATTCAACATGGATTCTACGTCTTGGAACCAGGCTAATTTGGGAGCGGCTTTGTGATAATGGAACCACCCAGCAAAAAGCATTAACGATGCAAA
AATCAATGCACCGATTGCGGTACAATAGAGTTGTAATTCACTAGTTATTCCGGATGCTCGCCAAATCTGAAAAAACCCGGAGGTTATTTGGATTCCTCGG
AAACCCCCGCCTACATCACCATTCAATATTTCTTGCCCTACGATTGGCCAAACTACCTGAGCACTGGGTCCAATGTGAGTAGGATCACTTAGCCATGCTT
CATAATTGGAAAAACGGGCACCATGGAAGTACATGCCACTCAACCAAAGAAAGATAATGGAGAGTTGACCGAAATGAGCACTAAAGACTTTTCGAGAGAT
CTCCTCCAAATCACCTGTATGACTATCGAAATCGTGAGCATCAGCATGTAGGTTCCAGATCCAAGTGGTAGTATCAGGGCCCTTAGCTATTGTTCTTGAG
AAATGGCCGGGTCTGGCCCATTCCTCAAAAGATGTTTTTACAGGATCCCTATCCACAACAATTTTTACTTCTGGTTCCGGCGAACGAATCATCATTAAGT
CCTCCTCTTTCCGGACAAGACATACAAAGAGACCCGCCAACTTTTTAGTGAACCTTTGAAAGATAGATATTATGATTAGTCCTTTTCTTTACTATCTACC
GTCCTTCTATTTTTTTTTAGTTATTCACTGGAGCAATTATATATTGAAGTCAATCTGAGGCAAGTGTTCGGATCTATTATGACATAAGGATTGGGTGCCT
AACGGACTTTTTTTATCTTGGATTTCTCCACGTAACAAAAAAACCTTTTTTTAATTTAAAAAGCTAGTCTATTTTTTTTAAGAGTATAAGTCCCTATCTA
TATCTACTTTCCTTGAGCATAATATAGATTTTTTTATTCGATTCCAAATTCCAAGATAACTCATTAGAATTATTAATAAGATGGTCCTGATATATTAGCA
ATATTTATATTGCCCCTTTTTATTCGCTTTATTACTTCTATTCTAGACCCTATCGTTTATCCTTATGAAATATAATATAAAATAGAAGGCAGAGGAAAGA
GATATAATGAAATTCTTGATTCGATCTTCCGACCTAATTTATTTGATTAATGGATCAACAACCAAACCCCCATTTTCTGAAAAAGGAGAGTGGTCTTATT
CAAATTCAAAGCGCTTCGTAATCTTCAACCAGTTCTGTGCTTCAATATAATTTCCCGGAGTAAGCGCTATAGCTTGTTTCCAATACTCAGCAGCTTGATC
AAACCAAGCTTCTGCAATTTCTGAATCACCCTGTAGAATGGCCTGTTCTCCCCGGTCGGAATAGATCACGGCCATATTATTAAAAGCTTGTGGTAAGAAG
GGGTTTCGTTCTAGTGCCCGGAAATAATATTCCAAAGCCTTTGTATGCTCTCCATTGCTTGTGTGTATAAGGCCTATGTTATAGAGTATATAACTTCGAT
CATAGGGATCAATTTCTAGTCGCGTAGCTTCATAATAATTTTGCAAAGCTTCCGCATAATTTCCTTCGGATTGAGCCAACATCCGTTACGGTCGTTCGTT
CTATTCAAAAAATCTCCGTTCCAAAACCGTACATGAGGTTTTCACCTCATACGGCTCCTCCCTTCTGTACATAGTACTAAGCGAAAAAATCTAGAGAATA
AAAATAGAATTAGTTCCATCTCATTATGGACCGAAAGGGGCTGGTATTTTTCCAAGAAATCTCTAGCCAACCTTCCCACAAGAGGTTTTTCTTAACACCA
ATGAATTCTATTAATGCTAGAGGAAAACGATAGCTCCAAGAATTTCTTTGTTCTCAACGCCTCCTATTTAGAGGAATTAGCCACTTCAACGATCTTTGAT
GGTTATAGGGGTATCCAAAGTACAAACTTGATGGTTGTTTGTTATCCCAACCATTCTTCCCAGCCCTGATACCAATCAGGAAAGGGTTAATTTCTAACAA
AGTTTTTCTCTTGTTGATTCCTATTTCTAGGTGTAGTGCTTTTATCCCCTATGCTACCTATTAGTACTAGTAGAGTAGGATTAGCCTGTAATACAGAACC
TATCCTGTAGGTGTAACCTTTCGCTCAATACTAAAATCTACAATTGAAGCATCCGAGGCCGCGTCAGTCGAGGATACACGACAGAAGGAGTTGTTAGTTC
ACCTCACCTTCCCTAAGCGTGGGTTTCCCTTACTAATTTGGTTTTCTCTCCGCGAACCCCCACTCTTTCTCGTAAAACCGGGGTGTAGGTAGGGCTAAAA
AAACAAAAAAAAGAGTCAAATCGCACCATCTCTATAATAAGTAAATGCCCTTTTTTCCCCGGAGGTTGTCGGAATTATTCGCAATAAAATATTGGCTACA
ATTGAGAAGGTCTTATCAATGAAATTTCCATTTATACGGGATCTAGGCATAATTCCCAACCCATTCTATCATTCTATATAGAATTCTTTTCATTCCTTCA
CAAAATAACATAAAAAAAAAACAAATCCATTCAATTCTTATAAATCGATCCCTATGCTCCAAATGGATAAGAGAGGTATTTCTGCTCAGCCCAAATTCTC
TCTTTTTCCTTCTGTTTGAACAAGAAGAGATAGAAAATATTTGACTAAGATTGGATTTCATTCCACTTTCCTATTTCTTTTCTCAACAACAACTTCTCTC
ATCAACTATTTCGCATTTTCAAAGTCATTAATCGTCCCATACCCTATTTTCTATTTGATTGTATGGGGTAGGATACCTTATGCAAACAGAATTCTAGGGT
TCCTTTTTTATCGAATAAGAAGAATTCTTCCATTCTCTTTTTCTTTGGTTTGGGGAAAACCCAAACTAAAACTTTTCGAGGGAGCGGACTTCCTAGTAAA
AAAATCCTGGACCCGTCCACTTAGATGAAAAGGAATTTTTCTATCTAATAGAACAATGGAACTCTCGCGCGGTTGTGGTTGTACCTGTACTGCAGGAATA
GGAAAACTCGCTATTCACTCAGTTTTTTTTCCATAATAAGATTATGGAGGAGAGATGGCCGAGCGGTTCAAGGCGTAGCATTGGAACTGCTATGTAGACT
TTTGTTTACCGAGGGTTCGAATCCCTCTCTTTCCGTTTTTCTTAATTCAGCAACGTTAATGATTACAATGTATCAAATCAAATGACAATTTATTCCAGCA
ATAATACAATACCTTTATTTAATAGAAATTCTCTATACCAAATTACTATGGTATGTAAAATACACATAGAGGAAAGAACAAAAAACAAAAAGGAATCCTA
GGGTTAATCCATTTCTGTTAGGTGAATGGGAAAATACGAATTAAGAGCCTTAGGTCGATTTAGTTCGGGGAAAGGGGAAGGGGAAGAAAATTCTATGAAC
CTTTCCGTTTTTCCTTAAGTTCAAGTTTGACGAGAGTAATATTCTACAACTAACAACTCATTTATTTTGAGACCGACCCACTTCCTATCCAGGATTTTTT
TTACTAGTCCTTTATATTGCAATGTGTCAATCGTCAAATGCTTTGGCAATTTCCCTGGGTCGGATGAAGCAATAGAATTTTGAACCAGACGTTTTGATCT
TTGGTTATCCTTCGTAGTAATAATATCTCGGGGTTTGCAACGAAAACTTGGTATATCGACTATACGACCATTAACTAAAATATGTCTATGGTTAACTAAT
TGCCGGGCCTCGGGAATGGTTGAAGCCATACCTAATCGAAAAAGGATATTATCCAAACGCATTTCAAGTAATTGTAGTAAAACCTGACCTGTTGAACTTT
TTGCTTTTCCAGCGATATGTACATATCTAAGTAATTGTCGTTCTGTCAGACCATACGATATTGTTCTTTTTTCCCAGAATGGAATTTCTTTTTCAGATTA
CTTCCGGATTTAGGTGTTTTTCTAGTGAGTCCTGGTAAAGCTCCCAGACGGCGTATTTTTTTAAAACGAGGTCCTCGATAACGGGACATGAAGACTCCTT
TTTTTATTGAAATTTCATTTTACACAATTAATTTCATTGTATTTACATTACAGAATACATCGAAATTAAAACTGAATTAAAGTAAAGGATAAACAGAGTA
AAATCTACTAAAAGTACCACAAAAAAATGGAATTTCATCAACATCTGAATTTTTGTATATATAT