Detailed information on CNT30696414


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30116834Oryza sativaOryza nivara93.7299.6999.012222forward

Expression of CNT30696414

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MHAQMNQVCAFFLVLILKSQKQDWSFFILMQW*

>peptide 2 (39 aa)
MSLPPKLTVAINPSPVSNRFCCWLLLSMTEIEISQPQRP*

>peptide 3 (55 aa)
HLHPLLSFSSSLPLPHASPQRRRSHCRSSSRRPLLPASGSRPAAAAGLNRFRGSS*

>peptide 4 (48 aa)
PTFILFSLFLVLFLSLTLLPSAAAHTAAPPHAGRCSLPPAAAPQPLPA*

>peptide 5 (53 aa)
MRIFFSTDIEITKTGLVLFYSYAMVIKILNFLHATILAQSDPYILMLSSNSEN*

>peptide 6 (40 aa)
MCSCLPKCIYVIILDKLKCFLLLTPNNYKLELTYIYFSVK*

>peptide 7 (43 aa)
MYLYTCYSSNPTDSVLLYEELNTLVSFETASLLVFLTVAYDLY*

>peptide 8 (30 aa)
MNFYTCEQVLITNWMVLFLLSVGSILFDLL*

>peptide 9 (30 aa)
MILGDNYMVPFSGSAATLLDSDSMVLPMEL*

Sequence

>CNT30696414
CCCACCTTCATCCTCTTCTCTCTTTTTCTAGTTCTCTTCCTCTCCCTCACGCTTCTCCCCAGCGCCGCCGCTCACACTGCCGCTCCTCCTCACGCCGGCC
GCTGCTCCCTGCCTCCGGCAGCCGCCCCGCAGCCGCTGCCGGCCTGAATCGGTTCCGTGGCTCCTCATGAGTCTACCCCCCAAGCTAACCGTAGCCATCA
ACCCCTCACCAGTCTCCAATCGATTCTGCTGCTGGCTACTGCTCTCAATGACTGAGATTGAAATTTCCCAACCCCAGCGCCCCTGATTCAAGCGTGGCTC
AGACCAGCCGTCTCTCCCTCCCCGAGCTCCTCCTCTCTGATCCCCTTCTATCCCTACTTCTGTGACGTGATCTGATTGGTTGTTCTCTTAGGTGGTAATC
TACGATGAATTTTTATACTTGTGAACAGGTTCTAATAACCAACTGGATGGTGCTATTCCTGCTATCTGTAGGTTCTATATTATTTGATTTGCTATAATTG
GATGATGACTATATGCTATGGATGAATGAGTGAATGCATGCTCAAATGAATCAAGTATGCGCATTTTTTTTAGTACTGATATTGAAATCACAAAAACAGG
ATTGGTCCTTTTTTATTCTTATGCAATGGTAATCAAGATACTGAATTTTCTACATGCCACTATACTAGCACAATCAGATCCTTATATCCTTATGCTGAGT
AGTAATTCAGAGAATTAATTTGAATTCCTGCATACCAAATGCATCATAGTAATATGACTAAAATGATCACATGACCTAAAAACTATGCATCTTGATTTTG
TTGTCAAATATACTGACTACTAAAATAACTGGTAATTAATTGTGTTCTATGTTATTGGTCTTAGCAAAGTTATGCTGATCAACTACTAAGGTTCAGATCC
TAATGTTATGCTCTTCTAGGACTTATGATTAGGACTCATAGATTTCTGTTTATGGATCTACATTTATACTAAAGATGTACTTGTACACTTGCTATTCATC
CAATCCTACAGATTCGGTATTACTATATGAAGAACTAAATACATTGGTGAGTTTTGAGACTGCTAGTCTGCTAGTATTTCTCACTGTGGCATACGATTTA
TATTGATTAATACTTACAGAACTAATGTATGTCATGCTTTAATCTAGAATCATATGCTCTAGATGCTCTGCTATAGAGACTTATAACCCTACTCATTAAT
TCTAACTATTTATAATTTCAGGATTCACCAAAGAGATGCATGTGCAGCTGTTTACCTAAATGCATTTACGTAATAATTCTAGACAAACTAAAATGTTTCT
TGTTACTAACCCCAAATAATTATAAACTAGAATTAACCTATATTTACTTTTCAGTTAAATAAAAATATTTATGTCCTACTAGTTGCACTTCCTACTCTGC
AGCTCAAATTACTTAATATTCTTGTTCATCTTCTAATGGATGCAAATGCAACTCACAACTCCTACACATACTAGTATATGCATCACTCAAGAATCATGTC
ATGATATGATTGTACTTTCAGTTTAATCTCTTGATTACCTGCCATGATTTTAGGTGACAATTATATGGTTCCCTTCTCTGGTTCTGCAGCTACTCTTCTG
GACTCTGATTCAATGGTTCTCCCGATGGAACTGTGATTTCTCCTCTTTGAGCTGAAGCACCACCTGCTCCTCCAGAAACTGAAACCCCTCTCTTCTTGAA
GCTCAGGACTGAACACCTCTACTTCATCCAAGAACTAAATACCTTTGCTTCTCCTTCTTCAGATTTGGTTTCTCTCTCTCTCTTTCTTGTTGTTTCCCTG
TGGATAATAGGAATGAGATACGGTGTAATTGTGTTGCTGGCTACTAAGCTACTGCTCTGCTATTTTTCTCTGTTTTGAGCTGGTTTTACAACCGAACTGC
TGGCTGCTACTACTGCTGCGGCTGAGGATGCTGCTTGGGGTTGTTTTCCAGCCGATGCAACCGAGACTGATTCACAGATAGCTGGTTAATATATGTGTGA
ATTTTTTTTGTGAAGGCTGGGTGACTCACCTACTTTAGTTTTGGTGGTTGTTTCACTGACTGACACCTAAGCAGTGTTTGATCGGTGGTGTAATGTGGGA
TTTCACTAAATTTTTCTATTTAGATAAATTCTGATACAATTAGGTACTTTTGCACTTGAGTCCCTCGGGGTCTCTAAAATTGAAGGTTACTCTGAGATTA
GGGACTAATTTATAATTGTTCTAGAACTCATAGTCATTTTTGCAAGGTTACCAATTCTCCATATATTTTTGGTAGATAAATTTATGCTTCTATATGATGT
AGCCGTGCATCTATTTGCTTGCTGGGATTAAAATGATTTGCTCTAGTTTTATTTTCAATTTCACAATTCCT