Detailed information on CNT30696348


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT002513, E-value = 2e-128

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30109476Oryza sativaOryza longistaminata43.9935.8692.95553forward
CNT30104357Oryza sativaOryza rufipogon4260.6293.18528forward

Expression of CNT30696348

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MEERREERNESEIEKLIGDKCVEVSVIEVIYCIGYF*

>peptide 2 (30 aa)
MLKNKFQPNCITSYQIAKSKKEHMVFEQVL*

>peptide 3 (46 aa)
MIGVWFHSRSRSQSTACGMLTGPLYYFVFRCCSLIVIGLPGPNVSI*

>peptide 4 (69 aa)
MREQTNSDLLGSPYPTLQLLAFFFSFSSDFLSFRRFPVQLFVSRDFFSFSRAIFSFFFCKIIFSRVLSG*

Sequence

>CNT30696348
AGAAACCTTAGCTCTTAGCTTGATTAGAATCCATTAGCAAACGCAAGTAGTATGAGCAACCCTAGGTTCGACCTCAACAATTATATTTTGTTTGCGCACA
TTGGATTGTTGTTTGAACATTGATTTTTCTCGCGTATTATAGTATTGGTGTATCGATTAGTCGTGAGGCAACGTATGCAGCTTCCAGGAGGTGAACGTTG
ATCAATATTATATCAAGAATAAGAACTATCCTAAGCAGAGTGTTGAAGAGAAGCCCTTGTTAGTACGCTTGCGTACCTAACAAGATGATCGGAGTGTGGT
TCCATTCTAGGTCTCGTTCCCAGTCGACTGCTTGTGGCATGTTAACCGGGCCCTTGTATTATTTTGTCTTTCGCTGTTGTTCTCTGATAGTTATCGGCCT
GCCTGGCCCTAATGTAAGCATATAACTCTTTTAGCCTGAATTCATTCGTGATATGTTGTGATTCGGCTGTGTGTACCAACTACTGATCCAGGGATTGGTA
CTGATAAACACAGAAGATTTCCGATTTCCAAAATCGGGGATCGACAATTACTAAATCTAAATCTATAGTTATGTAATACTTCACTTTAAATTAGTAGTCA
CGTGATAAATTTAATATTAAACATGTAGTTTTATTATATATCATCTTGAATAAATATATAGTCTTGTAATAGTTTGATCATAGGTTTATTATTTTACTCA
AATTTTCAAAATGTTAAAAAATAAGTTCCAACCTAATTGCATAACTTCATATCAAATCGCTAAAAGCAAAAAGGAACACATGGTATTTGAGCAAGTACTA
TAAAATTTCTAAATACTAGTCATAAGATACCAATCAAGCTTAAATGGTAATATGGAGGAGAGGAGAGAAGAAAGAAATGAGAGTGAAATAGAGAAGTTAA
TTGGTGACAAATGCGTTGAGGTTAGTGTAATAGAGGTAATATATTGTATAGGTTATTTTTAAATTTATGAGAAGATGACGTGGATAAAACTTGCTTGAAC
CAACTTGGGGATGGTGTTTTCAAGCAGGAATCCTATCTCGCGCAGATGCGCGAGCAAACTAACTCGGATCTACTAGGCTCACCCTACCCTACACTGCAGT
TGTTAGCATTTTTTTTCTCTTTTTCGAGTGATTTCCTCTCCTTCCGTCGTTTTCCCGTGCAACTTTTTGTCTCTCGTGATTTTTTTTCTTTTTCTCGCGC
AATTTTTTCCTTTTTTTTTTGCAAGATTATTTTTTCCCGTGTGCTATCAGGCTAAGT