Detailed information on CNT30696341


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30696341

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MIKGSSHGHHFSRRATAYTVQFQLPNNLQSGLCSCNELLCWCLVV

>peptide 2 (58 aa)
MDILHNVYRHFQELLAYLSVAVPDDQRLKSWPSLLKKGYCLHSAVSAAKQSSVWFVLL*

>peptide 3 (31 aa)
MKGIIVIDGYFTQCISPLPRASCVPKCCCSR*

>peptide 4 (37 aa)
MAITSQEGLLPTQCSFSCQTIFSLVCALVMSYCAGAWW

Sequence

>CNT30696341
TTGGTGGTAGAGTGCCATGTTAAACCGTAGACAGCAAGTAACACAATTCTGATGGATGAAAGGGATAATAGTAATTGATGGATATTTTACACAATGTATA
TCGCCACTTCCAAGAGCTTCTTGCGTACCTAAGTGTTGCTGTTCCAGATGATCAAAGGCTCAAGTCATGGCCATCACTTCTCAAGAAGGGCTACTGCCTA
CACAGTGCAGTTTCAGCTGCCAAACAATCTTCAGTCTGGTTTGTGCTCTTGTAATGAGCTATTGTGCTGGTGCCTGGTGGTC