Detailed information on CNT30696336


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30595550Oryza sativaOryza meridionalis57.0559.0998.35182forward
CNT30100635Oryza sativaOryza rufipogon10015.0393.1319forward
CNT30577935Oryza sativaOryza barthii70.8510099.56226forward

Expression of CNT30696336

Peptides detected in this lncRNA

>peptide 1 (42 aa)
MSLSCGSFTKVVQCSICFRFSPNPLKVSTSAFRTLAAAIRHA*

Sequence

>CNT30696336
CTGACCTCCGTCGGCTGCTAACTTGTCATATTTGTTCTTCAGATAGCTTAATATAATTTCCTCGTCGTACAGGGAGAAGACTCCGCCCTCCGCGCCTCAC
TATAATGAACTGCTCAACATAATGTCTCTAAGCTGTGGATCTTTCACTAAGGTGGTCCAGTGCTCGATCTGCTTCAGGTTTAGTCCTAATCCCCTGAAGG
TCTCAACGTCTGCTTTCAGAACGTTGGCAGCAGCGATCCGCCATGCGTGACCTCGCCAATCAGAGACCTCTTGTGCCCATATCCTGTTGTTTCCATTCGA
CGTCCTCAGTATCTCCTCA