Detailed information on CNT30696332


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001085, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30117774Oryza sativaOryza nivara70.23100100717forward

Expression of CNT30696332

Peptides detected in this lncRNA

>peptide 1 (34 aa)
EDREVFLSIFSSAYAKEARGIPMTCSWLKPSIAW*

>peptide 2 (36 aa)
RRPGSFPFYFLLSICEGSQRNSNDMLLAEALHCLVR*

>peptide 3 (52 aa)
MKRAKREKKKAGRLLVKGLSLKIFFLLWHHIGYVPFAYTLGPHPFSWGSFRI*

>peptide 4 (30 aa)
MSLLLIPWGHTLLAGDHLESKQTNKKNPFH*

Sequence

>CNT30696332
AGAAGACCGGGAAGTTTTCCTTTCTATTTTCTCCTCAGCATATGCGAAGGAAGCCAGAGGAATTCCAATGACATGCTCCTGGCTGAAGCCCTCCATTGCC
TGGTAAGATAGCTCTCTCTCTTTCTCTGCTTGTGCACTGGAGCTTTAAGAGTTTCTTTCCCTGTGAGTAGTTGGCTCCCTGCTCCAGGCCATGTATGGGG
TTATATAAGGAGAAGCTACCTAAAGGATCAAAAAGCAAGCAAAACCTTCCTTGACTAAAGCAATGGACGTGAGAAGAACTCCTTGAGCTTTCAGCCCAGC
TAATGAGGAGTTCAGGCATCGGGCAAACACGTGGTTGATTACTTGGTTCAAATTTCAGACCAAACTGCGGGTACATATTTGGTCACCTTTCCACTTACAT
TTTGGTCACGTTTTTGTGATGAATGTTGTTCAGGATGCTCGACCATACTAAGAATGTCCACTTCTCAAGTTCGTATGACAAGATCGATGCTTCGATGAAC
CTGATGTGAAATTACTACAGAATATAGCTAGTAATGAGCAAAGCTAAACTATAAACACTGCTTCCTACTGAGAGAGTGCAATCAGGTCCAGAATCAAACC
AGACTTACTGACTGAGGCTGTAAAGAGCTGCAAAGATTCTTCAATGAATACTCAAAAAAATCTTCAATGTTTTGTTTCCAATCCTGCTGATGAAGAGGTA
AGTAGAAAATGAAAAGAGCAAAAAGGGAGAAAAAAAAGGCAGGCAGGTTGTTGGTGAAGGGCTTAAGTCTTAAGATCTTCTTTTTGTTGTGGCACCACAT
TGGCTATGTCCCTTTTGCTTATACCTTGGGGCCACACCCTTTTAGCTGGGGATCATTTAGAATCTAAACAAACAAATAAAAAGAATCCCTTCCATTGACA
GATTCAGAGTTCAAGAACATGGTGGCCCCAGGTGATGGCTGGGGCCTCTGATCTGATGTGTGATGAGACTAATCTGATGTGTAAAACTGCTCACTTTCCG
CTAATTATGACTTAATTTAAG