Detailed information on CNT30696070


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT000989, E-value = 3e-17

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30696070

Peptides detected in this lncRNA

>peptide 1 (31 aa)
FIHIKFIDPKFISQKVYIPDSNLILNSNISL*

>peptide 2 (29 aa)
VYTHKVYRPKVYKSKSLHTRFKFDFEFKY*

Sequence

>CNT30696070
GTTTATACACATAAAGTTTATAGACCCAAAGTTTATAAGTCAAAAAGTTTACATACCCGATTCAAATTTGATTTTGAATTCAAATATTAGTTTATAGACC
AAAAGTTTATAAGTCAAAAGTTTACATACCCGTTTCAAATTTAAATTTAAATTTAAATATTTTTTATATATAGTATTCACTGGTGGAGAAACCATCATTG
GTCGGTCGGCCAAATTCCACAATAGTCCCAGTTCCAATAAAAACCGGGAATAAAAAGCATCTTTAGTCCCGGTTTAAAAGCTGAGGGGTATTTTTTGATC
TTTAGTCTCGGTTGGTGTTACCAACCGGGACAAAGATCATTTTTAGTCCCGGTTGAAGAAGTTGTCAGGTCGTGTCAGGTCCCTATTATTTTTAGTCGCA
GTTGGTATAAACAACCAGGACTACAGATAGATTTTTAGTCCCGATTGATTATACCAACCGGGACTAAAAATCACCCCAAGCCGGCGCGATGTTTATCTCT
TGGCGCGTCGATCTGTCTGTCCCTCCTCAGTCTTATCCTTAGCTTTTCTGCCCCTCCACTAGTTCTCCTCCTCAGTCCTTCTCCTCTTCCTCCTTCTCCT
CCTCCCCTTCCCCTCTCCCCTGTCTTCTTGGCGGCGGCCGGCGC