Detailed information on CNT30696055


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT004301, E-value = 3e-133

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30696055

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MMDLYIKLSVCVPRLIPGRGFYAQISSEITSEFPGVT*

Sequence

>CNT30696055
GCTTGTTGTTTCCGTCGTTGCGAAGGTTCGCGAGTGCGTCGGAAGTGATCAAGAAGATTAATTGAAGACCGATTATTGCAAGTTGAAGAAAAAGGATCCA
GAAGGAGAAGACGTTTGGCTTATACCCCAGTTGAGCTGCCTGTGGGAGTGGAGCCGGAGCTTCGCTAGATTTTATTTTCCGCTGCAGTTTTCTTCATGGT
GAGGACTAAGTGCCTCTTAAGTAAGTATATATCGGTTTAGTTATTATGATGGATTTGTATATTAAATTGTCAGTTTGTGTACCTCGGCTGATTCCTGGAC
GAGGATTTTATGCACAAATAAGTTCGGAAATTACTAGTGAATTTCCGGGCGTGACATAGAGCAAAG