Detailed information on CNT30696053


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT005690, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30109401Oryza sativaOryza longistaminata7054.3796.88448forward

Expression of CNT30696053

Peptides detected in this lncRNA

>peptide 1 (57 aa)
MSLVRGFRVSLFVPCVGDSMSRESICGDGPGVGLGIRRRPWWSEIMRDIKARVDARG*

>peptide 2 (34 aa)
MTYDGVIVCVWDAELNLEGVQIWYDWLCKVSFLY*

>peptide 3 (32 aa)
MEIPYDIRWSYCVRMGCGVEFGRSPNLVRLVM*

Sequence

>CNT30696053
GTGCGTATGGGATGCGGAGTTGAATTTGGAAGGAGTCCAAATTTGGTACGATTGGTTATGTAAAGTTTCGTTCTTGTACTAGTGGGTTTCCTAAGGTGTT
TAGGACTCCTAGTATGAGTTTGGTTCGTGGCTTTAGGGTTTCTTTGTTTGTTCCATGTGTAGGTGACTCGATGTCTCGGGAGAGTATTTGCGGTGATGGA
CCGGGAGTCGGCTTGGGGATAAGACGACGTCCGTGGTGGTCAGAGATCATGCGGGATATTAAGGCTAGAGTTGATGCACGTGGTTGATGGAGATTCCATA
TGACATACGATGGAGTTATTGTGTGCGTATGGGATGCGGAGTTGAATTTGGAAGGAGTCCAAATTTGGTACGATTGGTTATGTAAAGTTTCTTTCTTGTA
CTAGTGGGTTTCCTAAGGTGTTTAGGACTCCTAGTATGAGTTTGGTTCGTGGCTTTAGGCTGCCTACCTCATGTATAAATAGAGGGGAAGCGTGAGGCTT
CCCGGTATCGTTTTATAGAGCAATTGAATTGAGTTTTGAGTTAGGGTTTCGAGTTTAGTCGAAATTTTTGTAAGGAGTGTTGTTGGTGCACTTTGTAAAC
ACAGAGAGAAGTAATAAAGTCGTCATCCACTTTAAGAGTT