Detailed information on CNT30696047


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30696047

Peptides detected in this lncRNA

>peptide 1 (98 aa)
IESLYNPSRHCSCALVAAAVVPVAGAASSLPLLQPWLVTAAIASSVATGEPFLFFSFPRIREKGLQRLYRRKKERKRQSNIEEFQRFRKLGKFVARYT*

>peptide 2 (90 aa)
RLRASTTLAATAPAPLSPLLLFLSPAPLLRCHCYSRGWSPQPSRHLSPPGNPFCFSPSRESERRVYRGCTGGRKKGKGRATLRNFSDFAN*

Sequence

>CNT30696047
AGATTGAGAGCCTCTACAACCCTAGCCGCCACTGCTCCTGCGCCCTTGTCGCCGCTGCTGTTGTTCCTGTCGCCGGCGCCGCTTCTTCGCTGCCACTGCT
ACAGCCGTGGCTGGTCACCGCAGCCATCGCGTCATCTGTCGCCACCGGGGAACCCTTTCTGTTTTTCTCCTTCCCGCGAATCAGAGAGAAGGGTCTACAG
AGGTTGTACAGGAGGAAGAAAGAAAGGAAAAGGCAGAGCAACATTGAGGAATTTCAGCGATTTCGCAAATTAGGGAAATTTGTCGCAAGGTACACCTGAG
ATCGGAATGCATGGGGGAAGTAGCACCCTTATATACACATCTATCATCACACTATCAAACTATATTGCATAATGACACTTGAACTATATCCTGGTTTGGT
ATTGTAATAATCTTTTAGATTTCTATTAGTTCTTTTCCATGGATTATATGGATGGATAGCACTGTGGGAATGATATTATTATTAGTTTAATTTATTACTA
CATGTTCTTTTCCATGGATTATATGGATGGATAGCGTTGTGGGAATGATATTATTATTACTTTAA