Detailed information on CNT30696020


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30696020

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MQDCAPSIEEEKRNQQGGNVIYPRKRKGQCIGEDEHGSTAMDELVT*

>peptide 2 (42 aa)
SRLYLTLVKHSKHDHSHGSRCMHMSSNQLVRSEQPRRGGGEK*

Sequence

>CNT30696020
GTCAAGACTCTATCTCACCTTGGTCAAGCACTCAAAGCATGACCACAGCCATGGCAGCAGATGCATGCATATGAGCTCCAACCAATTAGTGAGGAGTGAG
CAGCCCAGGAGAGGAGGAGGAGAGAAGTAGGGAGTGAGGAGCAAACAAATCAGTGAAATGCAAGATTGCGCCCCATCCATTGAAGAGGAGAAGAGAAATC
AGCAAGGAGGGAATGTGATTTACCCAAGGAAGAGGAAAGGCCAATGCATCGGCGAGGATGAACACGGGAGCACAGCCATGGACGAACTTGTCACCTAGGC
AAAGGAATGAGTAGAATGATAATTGGGTCAATCGGCAGTGCTACATAATTTCGATTCAACTACAGAAACTCAGGTTTGATCCCTTGCAAGAGTGAGCTGG
ATTAGAGATGGCCTTAATACTCCTAGGGACGAATTAAAGGTAGCTCTAACTATTCCTCTGTTGCGATCTCTGATGGTGGATTATTATTTGGCAAAATAAT
GGTTGTTAAATAATAATCTACAGTCTGGCACTTTTATCTTCATTGTTAAAAGTGTGGGGC