Detailed information on CNT30696018


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30353222Oryza sativaEragrostis tef23.678.0895.7771reverse complement
CNT30117532Oryza sativaOryza nivara2418.7597.2272forward

Expression of CNT30696018

Peptides detected in this lncRNA

>peptide 1 (52 aa)
MPPPPCRRWWWSCWSGGGRWAAPAPPSSWTSPRTCPATPPASCAAACTPGCRT

>peptide 2 (29 aa)
NNGGLIIDSCFAFFVVVVVVVIEPCAWWL*

>peptide 3 (73 aa)
MVVVACSILRCVMLWWLSIDHAAATVPPLVVVLLERRRPLGGAGASFFMDVTPHLSCHSSCVMCCCLHSRLQNA

Sequence

>CNT30696018
CAATAATGGTGGATTAATAATCGATTCTTGCTTTGCTTTCTTCGTCGTCGTCGTCGTCGTCGTAATTGAGCCGTGTGCATGGTGGTTGTAGCTTGTAGTA
TACTTAGGTGTGTGATGCTGTGGTGGCTATCGATCGATCATGCCGCCGCCACCGTGCCGCCGCTGGTGGTGGTCTTGCTGGAGCGGCGGCGGCCGTTGGG
CGGCGCCGGCGCCTCCTTCTTCATGGACGTCACCCCGCACTTGTCCTGCCACTCCTCCTGCGTCATGTGCTGCTGCCTGCACTCCAGGCTGCAGAACGCC