Detailed information on CNT30695946


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT001181, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30105782Oryza sativaOryza longistaminata14.2166.3698.94284forward
CNT30102490Oryza sativaOryza rufipogon33.1239.6294.86662forward
CNT30577005Oryza sativaOryza barthii63.587392.451271forward
CNT30116277Oryza sativaOryza nivara45.42101.4592.84908forward

Expression of CNT30695946

Peptides detected in this lncRNA

>peptide 1 (88 aa)
MPARGEPLPPPFRLYISPSRPATYLPGCASLGNTRGHRRQGRSSTGASAPLLSLLSVCSAGREKEAEEGRKEEEEREKKKKRQITDRS*

>peptide 2 (62 aa)
LFSLSIHGRSSTPSVDLPIRSSTSPVLAPPASPPSGESVFPLSPLPPPLSQATTAIIHAGSR*

>peptide 3 (53 aa)
MRSRIWKESKFGMIGYVKFVSCTRGFLKVFRTPSMSLVRGFRLPTSGINRGGA*

>peptide 4 (49 aa)
MVSYDQFPLNTSGTPELLLLLLILRSEHMRIQVHGTGAIIVNDLMLGHD*

>peptide 5 (48 aa)
SSLSPSMADRRRRRSISPSVAPPPLSSRHRLRLHPASPFFPFPLFLHL*

>peptide 6 (31 aa)
MFYKFCYNFSRLSNTAFCKEPYYMSMHIIFP*

Sequence

>CNT30695946
TCTCTTCTCTCTCTCCATCCATGGCCGATCGTCGACGCCGTCGGTCGATCTCCCCATCCGTAGCTCCACCTCCCCTGTCCTCGCGCCACCGGCTTCGCCT
CCATCCGGCGAGTCCGTTTTTCCCCTTTCCCCTCTTCCTCCACCTCTAAGTCAAGCCACCACCGCCATCATCCATGCCGGCTCGAGGTGAACCCTTGCCG
CCGCCGTTCCGGCTATATATCTCTCCCTCTCGGCCAGCCACCTACCTCCCCGGGTGCGCGTCGCTCGGGAACACGCGTGGCCACCGCCGTCAAGGCCGTT
CATCCACCGGAGCATCGGCGCCCCTCCTCTCCCTTCTCTCTGTTTGCTCGGCTGGAAGAGAAAAAGAAGCAGAAGAAGGAAGGAAGGAGGAAGAAGAAAG
AGAAAAGAAGAAGAAAAGACAAATAACTGACAGGTCTTGAGGATTCTTCTGACACACTAGATAATATCAGTCAATCTCAGGACATCGAGCAAGGCAAGTT
ACCATATACCTTTTGATCATTTAAGCCTATATTTTACAAATTATTTAATTATAGCCTTCTATTCAATATTCTATTTTCTATGCATAAATTAATCATAGAA
ACTCAGATAATTTAGTATTGCTTATTTTGCTTACAATCTGGTTAAAATACCCTATACTTAGATTGGGACAATACGTATGATTTGGATGATTTCCGGGTGG
CTAGTATTGTCTCAATCGATATAAGTTCTACCAGGTACTTATGTCGAACGAACGGGTACGACCGCAGTTTCTAGAATGGGGACAGACCTAGTTATTAGGT
TAATTGGCAATATGGCACCTCTGTATAGTGGTTCTTATTTTTAAGTCCTCGCGCAGGAGGCAACTATAGCCGCGAAGGGCAAATTTAACCATTACCATGT
ACAGGTAAATGGTTTGCGATACTCGAGTATAAATTATATGGTATATTTCTAAACCCTGATCGAGATGACATGGTGTCATACGATCAGTTCCCCTTAAATA
CCTCGGGAACGCCAGAACTCCTCTTGCTTCTGTTAATATTACGTTCAGAGCATATGAGGATACAAGTTCATGGAACAGGTGCCATAATTGTTAATGACTT
AATGCTGGGCCATGACTAAAGCCGATAATTATCAGCAAGTCGTGGACTGCGGGTAAAGCGTACATCTGCTGCAGTAGAATATCTTTGAAACTATTCGAAT
AGCCGTACTCATGGAGTTGAGTACCGGGACTCATATGGTACCCTGGTTAGAAATCTAAAGTTTATATGTTTTATAAATTCTGCTATAACTTTTCCAGATT
GTCCAATACCGCTTTTTGCAAAGAACCCTATTATATGTCAATGCATATCATATTTCCGTGATAACTTGCTGAGTATTGCGAATACTCACCCTTGCTCTTA
TTAACCCTTTTTCAGATTTGGGTCAAGAGGAGGACCCCTGTGATTATTATTATGATGACTCTGATAACTTAGAAAATCCCTAGAGGTTATACCTTCCTAG
TCAGAATGTACTAGAACTTCCGCTGTGTAATATTAGTACCTATGTTTAATTAGGTGAGTACCTACCCTTGTAAAACCCCTAGTATTGTAAACTTTAACGT
ATGCAATGAAGAACCAGTTTTATTACATGTATCAATATTTACTGATCCAGGGATTGATACATTAATTTCAGTCGGATCCAAGTTATTAGTTTTGGGCTCC
GACATATTGTGTGCATATGAGATGCGGAGTCGAATTTGGAAGGAGTCCAAATTTGGTATGATTGGTTATGTAAAGTTTGTTTCTTGTACTAGAGGGTTTC
TTAAGGTGTTTAGGACTCCTAGTATGAGTTTGGTTCGTGGCTTTAGGCTGCCTACCTCGGGTATAAATAGAGGGGGAGCGTGAGGCTTCCCGGTATCGCT
TTAGAGAGCAATTGAGTTGAGTTTTGAGTTAGGGTTTCGAGTTTAGTCGAAATTTTTGTAAGGAGTGCTGTTAGTGCACTTTGTAAACACAAAGAGAAG