Detailed information on CNT30695897


BLAST search results

BLAST vs Swiss-Prot:
sp|Q76H85|H4_SILLA, E-value = 2e-49

BLAST vs NONCODE:
NONGMAT001327, E-value = 1e-19

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30554906Oryza sativaOryza glaberrima8081.6697.46472forward
CNT30438244Oryza sativaAegilops tauschii42.251.2393.98249forward
CNT30596905Oryza sativaOryza meridionalis88.1485.5393.46520forward
CNT30370989Oryza sativaOryza glumipatula29.1527.5298.84172forward
CNT30103387Oryza sativaOryza rufipogon73.3946.46100433forward
CNT30577582Oryza sativaOryza barthii93.0586.3298549forward
CNT30117527Oryza sativaOryza nivara79.6681.697.87470forward

Expression of CNT30695897

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MRFTPPLLASLRIAGFVIPWMLSRSTFLCLFAPPFPS

>peptide 2 (35 aa)
MKQQLQEKRLGYYDELKNMALIESLSNRVASHRLA*

>peptide 3 (50 aa)
SKSETARALEISKSLKTNWAIQVNQCHQLEQCRLQNVHIARQEIATEFRG*

Sequence

>CNT30695897
AGCAAATCAGAAACTGCTCGTGCTCTTGAAATTTCAAAATCGCTCAAAACAAATTGGGCAATACAGGTCAACCAGTGTCACCAACTAGAACAATGCAGGT
TGCAAAACGTTCACATAGCACGGCAAGAGATTGCAACTGAATTTAGAGGGTAAATCACTGCAGATTTCCTATTCCATTCGAACGAACGAACCAGTAGTTC
ATACATCCCTAATTAATGAAGGAACAGGAGACGAGATGAAACAACAGCTACAGGAGAAGAGGCTAGGCTACTACGACGAACTGAAGAACATGGCACTAAT
CGAATCCCTATCCAATCGCGTGGCCTCGCATCGCCTCGCCTAGCCGCCGAATCCGTAGAGGGTGCGGCCCTGGCGCTTGAGCGCGTAGACGACGTCCATG
GCGGTGACGGTCTTGCGGCGGGCGTGCTCCGTGAAGATCTTGAGCACGCCGCGGGTCTCCTCGTAGATCAGCCCGGAGATGCGCTTCACGCCGCCCCTCC
TCGCCAGCCTCCGGATCGCCGGCTTCGTGATCCCCTGGATGTTGTCGCGCAGCACCTTCCTGTGCCTCTTCGCGCCGCCCTTCCCGAGCC