Detailed information on CNT30695799


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30695799

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MAEVALDQSWSDKPPRQTWIQFRSGRSVRYECHPRKHCAS*

>peptide 2 (39 aa)
MYYALPMQFVASSWAPCVLILGRKTELTNLGVQNSQKKT*

>peptide 3 (39 aa)
MPAGKVISASFLVKMGRYVARAEFGNSKPLLVNSREIFI*

>peptide 4 (29 aa)
MCMHSCWLKEIIQGDMMPKQEDRGQGCSR*

>peptide 5 (38 aa)
MLFQCNLLLHLGPPVYSSLVEKQSLQTWEFKIAKKKLS*

>peptide 6 (41 aa)
MNAILASIAQVDSGDILEKKKSIVVMRKAQEEDKRTSEAAS*

Sequence

>CNT30695799
ATGAAAAGTAGAGAGGGGGGTGATCAAGTGGAGCATGGGATAACTACTGGGTGATGCATTAGTTCAGCTAAGTTGAGCGGGGCACGTTTGGAATGACTTG
GCACATGCTTGCTTGCTAACTTATGTAATTCGTGGGTATCCTCATAGTTAAGCTATGTTTCACTTGAGGTATGCCTGCAGGTAAGGTAATTTCTGCTAGC
TTTCTTGTAAAGATGGGAAGGTATGTAGCTAGGGCTGAGTTTGGGAACTCCAAGCCTCTTTTAGTAAATAGTAGAGAGATATTTATTTAATTCCTGAAAA
ATTGTGTGAAGTGAGAGTTACTAGTAGTGCCTGCAGGTGATATATGGCATAAGTAACCCAACAGGTGACAAGTAACCCCCGTTATTCTTGTAATGTATTA
TGCTCTTCCAATGCAATTTGTTGCTTCATCTTGGGCCCCCTGTGTACTCATCCTTGGTAGAAAAACAGAGCTTACAAACTTGGGAGTTCAAAATAGCCAA
AAAAAAACTTAGCTAGCTAGGTGAAAGTAATGCTTAATTAATATTTTTTGTGTATTGTCCTCTTGCAAAGTTGATGTGCACAGGCAACTGCATCAGATCT
ATAACATACCCTACCATATTACAGTGAAACGGAGGAGATCTCAGGGAATGGCTGAAGTTGCATTGGACCAATCTTGGTCCGACAAGCCTCCAAGACAAAC
TTGGATTCAATTTCGTTCTGGCAGATCGGTAAGGTATGAATGCCATCCTCGCAAGCATTGCGCAAGTTGATAGTGGTGATATTCTTGAAAAGAAAAAATC
GATAGTGGTAATGAGAAAAGCACAGGAGGAGGACAAGAGGACAAGTGAGGCGGCAAGCTAAGAAGACGGTGGCTTGGCGTGCTTGGCGTAATCTAACTTG
ATTACCAGGCAGAGGCAGACAAACACAGCTGGATTCTAGCTCGATGGAAGATGTTCCTGCCACATGTGCATGCATTCATGCTGGCTTAAGGAAATTATTC
AGGGAGACATGATGCCCAAGCAAGAAGATCGAGGGCAGGGCTGCTCCAGATGAGATCATCAGCCGCAGCTACACCTCTACCTCTGCTTCTTGTTTTCCTC
TACCTGTAGGCTGTAGCAACAACAAGTTTTCCTCTACCCCTCTGCTTCTTGTTTAGCAACAACAATAGTACTACTGCTCTGCTTCCTGTGTGTCATCTGC
ATCAATGATCTGTGATGATCTATTGGATGTATCTCAGTATCTGTGCTTATAGCTTTCCACCATCGAATCGAACATGCACGACTCATTTTC