Detailed information on CNT30695784


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT006839, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30103054Oryza sativaOryza rufipogon72.3480.4798.53408reverse complement

Expression of CNT30695784

Peptides detected in this lncRNA

>peptide 1 (56 aa)
RKLAYFSLPYVYIILGKTCEYILVLNPVSAISGEESGFELCFLCGHCSTEGGEGNE*

>peptide 2 (35 aa)
MCHVPRCTLTLLWYLLCLLIACDESVRLVAFLGTS*

>peptide 3 (28 aa)
MEESSFLRSSMSNFLKQSSLKKLHNSIIA

Sequence

>CNT30695784
AGAAAACTTGCATACTTCTCTCTCCCTTATGTATATATAATTTTGGGTAAGACTTGCGAGTACATTCTTGTACTTAACCCGGTGTCTGCAATTTCAGGAG
AGGAATCCGGTTTTGAGTTATGCTTCTTGTGTGGTCATTGCTCTACCGAGGGCGGCGAGGGCAATGAGTGATCTCTTGCGGCTTGGCTCTTGCCCGGTTG
GTTTGCCCTAGCGGAGTTGTGGCACCACCGGTTTTATCTTTTGCTTATGAACTCTAATTGAGACTTCCACTGCTATATTTATGTGTTGTATGTTGGGACC
TCGGACCCTATTATGTGTCATGTACCTCGCTGCACTTTAACCCTATTATGGTACTTGCTATGTTTATTAATTGCTTGCGATGAAAGTGTGAGGCTAGTCG
CATTCCTGGGGACTAGCTAATTATATCAAACAGTGAAGGAGGAAATATCTTCTCAAATTTGCACAGAGTTACCGCAATGGAGGAATCTAGCTTTTTAAGG
AGCTCCATGTCTAACTTCTTGAAGCAAAGTTCTCTGAAAAAGTTGCACAACTCAATTATTGCCT