Detailed information on CNT30695714


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9ZT94|POLR2_ARATH, E-value = 4e-07

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30523266Oryza sativaSetaria italica41.1433.4986.6209forward
CNT30554770Oryza sativaOryza glaberrima52.1776.8198.11265forward
CNT30109102Oryza sativaOryza longistaminata10077.5699.8508forward
CNT30103073Oryza sativaOryza rufipogon98.8297.86100502forward
CNT30117494Oryza sativaOryza nivara10079.1399.21508forward

Expression of CNT30695714

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MKAALAVGFSSKSLGFENSCEANWELLMFENS*

>peptide 2 (29 aa)
EQQMAVERQMEQNVSFHWVKLAYLVERMV*

>peptide 3 (91 aa)
MAGSLACLRIHEKLVGSLACLRIHEKLAGSFARVCQYQGLLEYQKVGEWLLLGLQANPMTLNQYQTHSLHQDVRQHLQLVFPHVSPLEEEV*

>peptide 4 (35 aa)
MRSWLGALHVCVNIRGCWSIRRWANGCFWDFRQIQ*

Sequence

>CNT30695714
GGGAACAGCAAATGGCGGTGGAGAGGCAAATGGAACAAAATGTTTCTTTTCATTGGGTGAAACTGGCATACTTGGTTGAGCGAATGGTGTAGGAATATGT
TCTGAACCTTTTGGCTGAGTCATGAAAGCAGCATTAGCTGTTGGATTCTCTTCCAAGTCACTTGGGTTTGAGAATTCATGCGAAGCCAACTGGGAGCTTT
TAATGTTTGAGAATTCATGAGAAGATGGCTGGGAGCTTGGCATGTTTAAGAATTCATGAGAAGTTGGTTGGGAGCTTGGCATGTTTGAGAATTCATGAGA
AGTTGGCTGGGAGCTTTGCACGTGTGTGTCAATATCAGGGGTTGCTGGAGTATCAGAAGGTGGGCGAATGGCTGCTTTTGGGACTTCAGGCAAATCCAAT
GACTCTAAACCAGTATCAGACTCATAGTCTTCATCAGGATGTTCGGCAGCACTTGCAGCTAGTGTTTCCTCATGTTTCTCCTTTGGAAGAGGAAGTGTAG
AACCATTG